|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 7538 |
Name | ZFP36 |
Synonym | G0S24|GOS24|NUP475|RNF162A|TIS11|TTP;zinc finger protein 36, C3H type, homolog (mouse);ZFP36;zinc finger protein 36, C3H type, homolog (mouse) |
Definition | G0/G1 switch regulatory protein 24|growth factor-inducible nuclear protein NUP475|tristetraprolin|tristetraproline|zfp-36|zinc finger protein 36 homolog|zinc finger protein, C3H type, 36 homolog |
Position | 19q13.1 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
potential | Findings demonstrate the ability of TTP to act as a tumor suppressor by inhibiting the E6-AP pathway and indicate TTP loss to be a critical event during HPV-mediated cervical cancer carcinogenesis. |
More detail of all 1 literatures about ZFP36 | |
Pathways and Diseases |
|
Pathway | ErbB1 downstream signaling;PID Curated;200113 |
External Links |
|
Links to Entrez Gene | 7538 |
Links to all GeneRIF Items | 7538 |
Links to iHOP | 7538 |
Sequence Information |
|
Nucleotide Sequence |
>7538 : length: 981 atggatctgactgccatctacgagagcctcctgtcgctgagccctgacgtgcccgtgcca tccgaccatggagggactgagtccagcccaggctggggctcctcgggaccctggagcctg agcccctccgactccagcccgtctggggtcacctcccgcctgcctggccgctccaccagc ctagtggagggccgcagctgtggctgggtgcccccaccccctggcttcgcaccgctggct ccccgcctgggccctgagctgtcaccctcacccacttcgcccactgcaacctccaccacc ccctcgcgctacaagactgagctatgtcggaccttctcagagagtgggcgctgccgctac ggggccaagtgccagtttgcccatggcctgggcgagctgcgccaggccaatcgccacccc aaatacaagacggaactctgtcacaagttctacctccagggccgctgcccctacggctct cgctgccacttcatccacaaccctagcgaagacctggcggccccgggccaccctcctgtg cttcgccagagcatcagcttctccggcctgccctctggccgccggacctcaccaccacca ccaggcctggccggcccttccctgtcctccagctccttctcgccctccagctccccacca ccacctggggaccttccactgtcaccctctgccttctctgctgcccctggcacccccctg gctcgaagagaccccaccccagtctgttgcccctcctgccgaagggccactcctatcagc gtctgggggcccttgggtggcctggttcggaccccctctgtacagtccctgggatccgac cctgatgaatatgccagcagcggcagcagcctggggggctctgactctcccgtcttcgag gcgggagtttttgcaccaccccagcccgtggcagccccccggcgactccccatcttcaat cgcatctctgtttctgagtga |
Protein Sequence |
>7538 : length: 326 MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTS LVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRY GAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPV LRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPL ARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE AGVFAPPQPVAAPRRLPIFNRISVSE |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |