|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 7832 |
Name | BTG2 |
Synonym | PC3|TIS21;BTG family, member 2;BTG2;BTG family, member 2 |
Definition | B-cell translocation gene 2|NGF-inducible anti-proliferative protein PC3|nerve growth factor-inducible anti-proliferative|pheochromacytoma cell-3|protein BTG2 |
Position | 1q32 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 5 PubMed records as below. |
Evidence Status | Description |
reviewed | "Skp2 enhances polyubiquitination and degradation of TIS21/BTG2/PC3, tumor suppressor protein, at the downstream of FoxM1." |
reviewed | Estradiol downregulation of the tumor suppressor gene BTG2 requires estrogen receptor-alpha and the REA corepressor. |
reviewed | PC3 / BTG2 acts as a tumor suppressor of medulloblastoma by its antiproliferative and prodifferentiative effect on cerebellar progenitors. This antagonizes Shh and appears physiologic since endogenous PC3 / BTG2 decreases in human medulloblastomas. |
reviewed | "BTG2 expression was found to be significantly reduced in a large proportion of human kidney and breast carcinomas, suggesting that BTG2 is a tumor suppressor that links p53 and Rb pathways in human tumorigenesis." |
potential | "The human BTG2/TIS21/PC3 gene: genomic structure, transcriptional regulation and evaluation as a candidate tumor suppressor gene." |
reviewed | PC3/Tis21/BTG2 is a tumor suppressor of medulloblastoma. |
| More detail of all 5 literatures about BTG2 | |
Pathways and Diseases | |
Pathway | btg family proteins and cell cycle regulation;PID BioCarta;100224 |
Pathway | Direct p53 effectors;PID Curated;200101 |
External Links | |
Links to Entrez Gene | 7832 |
Links to all GeneRIF Items | 7832 |
Links to iHOP | 7832 |
Sequence Information | |
Nucleotide Sequence | >7832 : length: 477 atgagccacgggaagggaaccgacatgctcccggagatcgccgccgccgtgggcttcctc tccagcctcctgaggacccggggctgcgtgagcgagcagaggcttaaggtcttcagcggg gcgctccaggaggcactcacagagcactacaaacaccactggtttcccgaaaagccgtcc aagggctccggctaccgctgcattcgcatcaaccacaagatggaccccatcatcagcagg gtggccagccagatcggactcagccagccccagctgcaccagctgctgcccagcgagctg accctgtgggtggacccctatgaggtgtcctaccgcattggggaggacggctccatctgc gtcttgtacgaggaggccccactggccgcctcctgtgggctcctcacctgcaagaaccaa gtgctgctgggccggagcagcccctccaagaactacgtgatggcagtctccagctag |
Protein Sequence | >7832 : length: 158 MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPS KGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSIC VLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |