|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 79577 |
Name | CDC73 |
Synonym | C1orf28|HPTJT|HRPT2|HYX;cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae);CDC73;cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) |
Definition | cell division cycle protein 73 homolog|hyperparathyroidism 2 protein|parafibromin |
Position | 1q25 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 10 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | The tumor suppressor CDC73 interacts with the ring finger proteins RNF20 and RNF40 and is required for the maintenance of histone 2B monoubiquitination. |
reviewed | The simultaneous loss of nucleolar localization and acquisition of a growth stimulatory phenotype with the L95P mutation raise the possibility that parafibromin must interact with targets in the nucleolus to fully execute its tumor suppressor functions. |
reviewed | The parafibromin tumor suppressor protein HRPT2 inhibits cell proliferation by repression of the c-myc proto-oncogene. |
reviewed | The parafibromin tumor suppressor protein interacts with actin-binding proteins actinin-2 and actinin-3. |
reviewed | Parafibromin tumor suppressor enhances cell growth in the cells expressing SV40 large T antigen. |
reviewed | These experiments identify for the first time a proapoptotic activity of endogenous parafibromin likely to be important in its role as a tumor suppressor and show a functional role for the NLS of parafibromin in this activity. |
reviewed | Identification of a functional bipartite nuclear localization signal in the tumor suppressor parafibromin. |
reviewed | findings link the tumor suppressor parafibromin to the transcription elongation and RNA processing pathway as a PAF1 complex- and RNA polymerase II-bound protein. |
reviewed | The parafibromin tumor suppressor protein is part of a human Paf1 complex. |
reviewed | Human parafibromin is a nucleocytoplasmic tumor suppressor protein which regulates cyclin D1/PRAD1 expression. |
| More detail of all 10 literatures about CDC73 | |
|
External Links |
|
Links to Entrez Gene | 79577 |
Links to all GeneRIF Items | 79577 |
Links to iHOP | 79577 |
|
Sequence Information |
|
Nucleotide Sequence |
>79577 : length: 1596 atggcggacgtgcttagcgtcctgcgacagtacaacatccagaagaaggagattgtggtg aagggagacgaagtgatcttcggggagttctcctggcccaagaatgtgaagaccaactat gttgtttgggggactggaaaggaaggccaacccagagagtactacacattggattccatt ttatttctacttaataacgtgcacctttctcatcctgtttatgtccgacgtgcagctact gaaaatattcctgtggttagaagacctgatcgaaaagatctacttggatatctcaatggt gaagcgtcaacatcggcaagtatagacagaagcgctcccttagaaataggtcttcagcga tctactcaagtcaaacgagctgcagatgaagttttagcagaagcaaagaaaccacgaatt gaggatgaagagtgtgtgcgccttgataaagagagattggctgcccgtttggagggtcac aaagaagggattgtacagactgaacagattaggtctttgtctgaagctatgtcagtggaa aaaattgctgcaatcaaagccaaaattatggctaagaaaagatctactatcaagactgat ctagatgatgacataactgcccttaaacagaggagttttgtggatgctgaggtagatgtg acccgagatattgtcagcagagagagagtatggaggacacgaacaactatcttacaaagc acaggaaagaatttttccaagaacatttttgcaattcttcaatctgtaaaagccagagaa gaagggcgtgcacctgaacagcgacctgccccaaatgcagcacctgtggatcccactttg cgcaccaaacagcctatcccagctgcctataacagatacgatcaggaaagattcaaagga aaagaagaaacggaaggcttcaaaattgacactatgggaacctaccatggtatgacactg aaatctgtaacggagggtgcatctgcccggaagactcagactcctgcagcccagccagta ccaagaccagtttctcaagcaagacctcccccaaatcagaagaaaggatctcgaacaccc attatcataattcctgcagctaccacctctttaataaccatgcttaatgcaaaagacctt ctacaggacctgaaatttgtcccatcagatgaaaagaagaaacaaggttgtcaacgagaa aatgaaactctaatacaaagaagaaaagaccagatgcaaccagggggcactgcaattagt gttacagtaccttatagagtagtagaccagccccttaaacttatgcctcaagactgggac cgcgttgtagccgtttttgtgcagggtcctgcatggcagttcaaaggttggccatggctt ttgcctgatggatcaccagttgatatatttgctaaaattaaagccttccatctgaagtat gatgaagttcgtctggatccaaatgttcagaaatgggatgtaacagtattagaactcagc tatcacaaacgtcatttggatagaccagtgttcttacggttttgggaaacattggacagg tacatggtaaagcataaatcgcacttgagattctga |
Protein Sequence |
>79577 : length: 531 MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSI LFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQR STQVKRAADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVE KIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQS TGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKG KEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTP IIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAIS VTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKY DEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF |