|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7980 |
Name | TFPI2 |
Synonym | PP5|REF1|TFPI-2;tissue factor pathway inhibitor 2;TFPI2;tissue factor pathway inhibitor 2 |
Definition | placental protein 5 |
Position | 7q22 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
potential | TFPI-2 is a putative tumor suppressor gene frequently inactivated by promoter hypermethylation in nasopharyngeal carcinoma. |
potential | "Expression, DNA methylation and histone modifications of TFPI2, a presumed tumor suppressor, and that of other genes in the 7q21 imprinted gene cluster in prostate cancer, were analysed." |
reviewed | Tissue factor pathway inhibitor-2 as a frequently silenced tumor suppressor gene in hepatocellular carcinoma. |
| More detail of all 3 literatures about TFPI2 | |
|
External Links |
|
Links to Entrez Gene | 7980 |
Links to all GeneRIF Items | 7980 |
Links to iHOP | 7980 |
|
Sequence Information |
|
Nucleotide Sequence |
>7980 : length: 708 atggaccccgctcgccccctggggctgtcgattctgctgcttttcctgacggaggctgca ctgggcgatgctgctcaggagccaacaggaaataacgcggagatctgtctcctgccccta gactacggaccctgccgggccctacttctccgttactactacgacaggtacacgcagagc tgccgccagttcctgtacgggggctgcgagggcaacgccaacaatttctacacctgggag gcttgcgacgatgcttgctggaggatagaaaaagttcccaaagtttgccggctgcaagtg agtgtggacgaccagtgtgaggggtccacagaaaagtatttctttaatctaagttccatg acatgtgaaaaattcttttccggtgggtgtcaccggaaccggattgagaacaggtttcca gatgaagctacttgtatgggcttctgcgcaccaaagaaaattccatcattttgctacagt ccaaaagatgagggactgtgctctgccaatgtgactcgctattattttaatccaagatac agaacctgtgatgctttcacctatactggctgtggagggaatgacaataactttgttagc agggaggattgcaaacgtgcatgtgcaaaagctttgaaaaagaaaaagaagatgccaaag cttcgctttgccagtagaatccggaaaattcggaagaagcaattttaa |
Protein Sequence |
>7980 : length: 235 MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQS CRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSM TCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRY RTCDAFTYTGCGGNDNNFVSREDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF |