|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 80023 |
Name | NRSN2 |
Synonym | C20orf98|dJ1103G7.6;neurensin 2;NRSN2;neurensin 2 |
Definition | neurensin-2 |
Position | 20p13 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
potential | NRSN2 could be a tumor suppressor gene for hepatocellular carcinoma and a candidate biomarker for long-term survival in HCC. |
More detail of all 1 literatures about NRSN2 | |
External Links |
|
Links to Entrez Gene | 80023 |
Links to all GeneRIF Items | 80023 |
Links to iHOP | 80023 |
Sequence Information |
|
Nucleotide Sequence |
>80023 : length: 615 atgatgccgagctgcaatcgttcctgcagctgcagccgcggccccagcgtggaggatggc aagtggtatggggtccgctcctacctgcacctcttctatgaggactgtgcaggcactgct ctcagcgacgaccctgagggacctccggtcctgtgcccccgccggccctggccctcactg tgttggaagatcagcctgtcctcggggaccctgcttctgctgctgggtgtggcggctctg accactggctatgcagtgccccccaagctggagggcatcggtgagggtgagttcctggtg ttggatcagcgggcagccgactacaaccaggccctgggcacctgtcgcctggcaggcaca gcgctctgtgtggcagctggagttctgctcgccatctgcctcttctgggccatgataggc tggctgagccaggacaccaaggcagagcccttggaccccgaagccgacagccacgtggag gtcttcggggatgagccagagcagcagttgtcacccattttccgcaatgccagtggccag tcatggttctcgccacccgccagcccctttgggcaatcttctgtgcagactatccagccc aagagggactcctga |
Protein Sequence |
>80023 : length: 204 MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSL CWKISLSSGTLLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT ALCVAAGVLLAICLFWAMIGWLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQ SWFSPPASPFGQSSVQTIQPKRDS |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |