|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 8099 |
Name | CDK2AP1 |
Synonym | DOC1|DORC1|ST19|doc-1|p12DOC-1;cyclin-dependent kinase 2 associated protein 1;CDK2AP1;cyclin-dependent kinase 2 associated protein 1 |
Definition | CDK2-associated protein 1|Deleted in oral cancer-1|cyclin-dependent kinase 2-associated protein 1|deleted in oral cancer 1|putative oral cancer suppressor |
Position | 12q24.31 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,Generif,UniProt |
Literature support | Count: 4 PubMed records as below. |
Evidence Status | Description |
potential | "Cloning, mapping, expression, function, and mutation analyses of the human ortholog of the hamster putative tumor suppressor gene Doc-1." |
potential | "Isolation, mapping and mutation analysis of a human cDNA homologous to the doc-1 gene of the Chinese hamster, a candidate tumor suppressor for oral cancer." |
reviewed | miR-21 downregulates the tumor suppressor P12 CDK2AP1 and stimulates cell proliferation and invasion. |
reviewed | Data support the role of cdk2ap1 as a tumor suppressor gene that can regulate squamous cell carcinoma growth in a cell autonomous manner through decreases in invasiveness and a non-cell autonomous manner through decreases in angiogenesis phenotypes. |
| More detail of all 4 literatures about CDK2AP1 | |
External Links | |
Links to Entrez Gene | 8099 |
Links to all GeneRIF Items | 8099 |
Links to iHOP | 8099 |
Sequence Information | |
Nucleotide Sequence | >8099 : length: 348 atgtcttacaaaccgaacttggccgcgcacatgcccgccgccgccctcaacgccgctggg agtgtccactcgccttccaccagcatggcaacgtcttcacagtaccgccagctgctcagt gactacgggccaccgtccctaggctacacccagggaactgggaacagccaggtgccccaa agcaaatacgcggagctgctggccatcattgaagagctggggaaggagatcagacccacg tacgcagggagcaagagtgccatggagaggctgaagcgcggcatcattcacgctagagga ctggttcgggagtgcttggcagaaacggaacggaatgccagatcctag |
Protein Sequence | >8099 : length: 115 MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQ SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |