|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8125 |
Name | ANP32A |
Synonym | C15orf1|I1PP2A|LANP|MAPM|PHAP1|PHAPI|PP32;acidic (leucine-rich) nuclear phosphoprotein 32 family, member A;ANP32A;acidic (leucine-rich) nuclear phosphoprotein 32 family, member A |
Definition | acidic leucine-rich nuclear phosphoprotein 32 family member A|acidic nuclear phosphoprotein pp32|cerebellar leucine rich acidic nuclear protein|inhibitor-1 of protein phosphatase-2A|leucine-rich acidic nuclear protein|mapmodulin|potent heat-stable protein |
Position | 15q23 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | MicroRNA-21 targets tumor suppressor genes ANP32A and SMARCA4. |
reviewed | Data provide evidence that the tumor suppressor function of pp32 can be attributed to its ability to disrupt HuR binding to target mRNAs encoding key proteins for cancer cell survival and drug efficacy. |
reviewed | tumor suppressor pp32 represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity. |
reviewed | regulatory roles of oncoprotein ProT and tumor suppressor PHAP in apoptosis. |
| More detail of all 4 literatures about ANP32A | |
|
Pathways and Diseases |
|
Pathway | granzyme a mediated apoptosis pathway;PID BioCarta;100035 |
Disease | Osteoarthritis, Hip;GAD |
Disease | Osteoarthritis, Knee;GAD |
Disease | METABOLIC;GAD |
|
External Links |
|
Links to Entrez Gene | 8125 |
Links to all GeneRIF Items | 8125 |
Links to iHOP | 8125 |
|
Sequence Information |
|
Nucleotide Sequence |
>8125 : length: 750 atggagatgggcagacggattcatttagagctgcggaacaggacgccctctgatgtgaaa gaacttgtcctggacaacagtcggtcgaatgaaggcaaactcgaaggcctcacagatgaa tttgaagaactggaattcttaagtacaatcaacgtaggcctcacctcaatcgcaaactta ccaaagttaaacaaacttaagaagcttgaactaagcgataacagagtctcagggggcctg gaagtattggcagaaaagtgtccgaacctcacgcatctaaatttaagtggcaacaaaatt aaagacctcagcacaatagagccactgaaaaagttagaaaacctcaagagcttagacctt ttcaattgcgaggtaaccaacctgaacgactaccgagaaaatgtgttcaagctcctcccg caactcacatatctcgacggctatgaccgggacgacaaggaggcccctgactcggatgct gagggctacgtggagggcctggatgatgaggaggaggatgaggatgaggaggagtatgat gaagatgctcaggtagtggaagacgaggaggacgaggatgaggaggaggaaggtgaagag gaggacgtgagtggagaggaggaggaggatgaagaaggttataacgatggagaggtagat gacgaggaagatgaagaagagcttggtgaagaagaaaggggtcagaagcgaaaacgagaa cctgaagatgagggagaagatgatgactaa |
Protein Sequence |
>8125 : length: 249 MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE PEDEGEDDD |