|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 83593 |
Name | RASSF5 |
Synonym | Maxp1|NORE1|NORE1A|NORE1B|RAPL|RASSF3;Ras association (RalGDS/AF-6) domain family member 5;RASSF5;Ras association (RalGDS/AF-6) domain family member 5 |
Definition | Rap1-binding protein|Ras association (RalGDS/AF-6) domain family 5|Ras effector-like protein|new ras effector 1|novel Ras effector 1|ras association domain-containing protein 5|regulator for cell adhesion and polarization enriched in lymphoid tissue|tumor |
Position | 1q32.1 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 8 PubMed records as below. |
Evidence Status | Description |
reviewed | "a novel regulatory network composed of the tumor suppressor NORE1A, the mitotic kinase Aurora A, the small GTPase Ras, and the microtubule cytoskeleton." |
potential | NORE1B suppresses replication and transformation of cells as effectively as RASSF1A and is a putative tumor suppressor gene. NORE1B interacts with RASSF1A and loss of one of these may lead to uncontrolled growth and transformation of hepatocytes. |
potential | Assessment of NORE1A as a putative tumor suppressor in human neuroblastoma. |
reviewed | Nuclear transport of Ras-associated tumor suppressor proteins: different transport receptor binding specificities for arginine-rich nuclear targeting signals. |
potential | The candidate tumor suppressor gene NORE1B is epigenetically down-regulated in hepatocellular carcinoma. |
reviewed | The growth and tumor suppressor NORE1A is a cytoskeletal protein that suppresses growth by inhibition of the ERK pathway. |
reviewed | Nore1 is a member of a family of Ras effector/tumor suppressors that includes RASSF1. |
reviewed | a direct role for RASSF5 in death receptor ligand-mediated apoptosis and provide further evidence for RASSF5 as a tumor suppressor. |
| More detail of all 8 literatures about RASSF5 | |
Pathways and Diseases | |
Pathway | TCR signaling in naive CD4+ T cells;PID Curated;200022 |
Pathway | TCR signaling in naive CD8+ T cells;PID Curated;200062 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Disease | smoking cessation;GAD |
Disease | CHEMDEPENDENCY;GAD |
External Links | |
Links to Entrez Gene | 83593 |
Links to all GeneRIF Items | 83593 |
Links to iHOP | 83593 |
Sequence Information | |
Nucleotide Sequence | >83593 : length: 1257 atggccatggcgtccccggccatcgggcagcgcccgtacccgctactattggaccccgag ccgccgcgctatctacagagcctgagcggccccgagctaccgccgccgccccccgaccgg tcctcgcgcctctgtgtcccggcgcccctctccactgcgcccggggcgcgcgaggggcgc agcgcccggagggctgcccgggggaacctggagcccccgccccgggcctcccgacccgct cgcccgctccggcctggtctgcagcagagactgcggcggcggcctggagcgccccgaccc cgcgacgtgcggagcatcttcgagcagccgcaggatcccagagtcccggcggagcgaggc gaggggcactgcttcgccgagttggtgctgccgggcggccccggctggtgtgacctgtgc ggacgagaggtgctgcggcaggcgctgcgctgcactaactgtaaattcacctgtcaccca gaatgccgcagcctgatccagttggactgcagtcagcaggagggtttatcccgggacaga ccctctccagaaagcaccctcaccgtgaccttcagccagaatgtctgtaaacctgtggag gagacacagcgcccgcccacactgcaggagatcaagcagaagatcgacagctacaacacg cgagagaagaactgcctgggcatgaaactgagtgaagacggcacctacacgggtttcatc aaagtgcatctgaaactccggcggcctgtgacggtgcctgctgggatccggccccagtcc atctatgatgccatcaaggaggtgaacctggcggctaccacggacaagcggacatccttc tacctgcccctagatgccatcaagcagctgcacatcagcagcaccaccaccgtcagtgag gtcatccaggggctgctcaagaagttcatggttgtggacaatccccagaagtttgcactt tttaagcggatacacaaggacggacaagtgctcttccagaaactctccattgctgaccgc cccctctacctgcgcctgcttgctgggcctgacacggaggtcctcagctttgtgctaaag gagaatgaaactggagaggtagagtgggatgccttctccatccctgaacttcagaacttc ctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcaaaagaagtatgac aagtttaggcagaaactggaggaggccttaagagaatcccagggcaaacctgggtaa |
Protein Sequence | >83593 : length: 418 MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGR SARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG EGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |