|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 83719 |
Name | YPEL3 |
Synonym | -;yippee-like 3 (Drosophila);YPEL3;yippee-like 3 (Drosophila) |
Definition | protein yippee-like 3 |
Position | 16p11.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Why YPEL3 represents a novel tumor suppressor. |
potential | "Findings point to YPEL3 being a novel tumor suppressor, which upon induction triggers a permanent growth arrest in human tumor and normal cells." |
| More detail of all 2 literatures about YPEL3 | |
|
External Links |
|
Links to Entrez Gene | 83719 |
Links to all GeneRIF Items | 83719 |
Links to iHOP | 83719 |
|
Sequence Information |
|
Nucleotide Sequence |
>83719 : length: 360 atggtgcggatttcaaagcccaagacgtttcaggcctacttggatgattgtcaccggagg tatagctgtgcccactgccgcgctcacctggccaaccacgacgacctcatctccaagtcc ttccagggcagtcaggggcgtgcctacctcttcaactcagtggtgaacgtgggctgcggg ccagccgaggagcgggtgctgctgaccggcctccatgctgtcgccgacatccactgcgag aactgcaagaccactttgggctggaaatatgaacaggcctttgagagcagccagaagtac aaagaggggaagtacatcattgaactcaaccacatgatcaaagacaacggctgggactga |
Protein Sequence |
>83719 : length: 119 MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCG PAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD |