|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 84289 |
Name | ING5 |
Synonym | p28ING5;inhibitor of growth family, member 5;ING5;inhibitor of growth family, member 5 |
Definition | inhibitor of growth protein 5 |
Position | 2q37.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
Evidence Status |
Description |
potential | "ING5 may function as a tumor suppressor gene or oncogene tightly linked with p53 status, and may play an important role in the prognosis of head and neck squamous cell carcinoma (HNSCC) patients." |
reviewed | Tumor-specific mutation and down-regulation of ING5 mRNA suggested it as a tumor suppressor gene in oral squamous cell carcinoma. |
reviewed | ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation. |
More detail of all 3 literatures about ING5 | |
External Links |
|
Links to Entrez Gene | 84289 |
Links to all GeneRIF Items | 84289 |
Links to iHOP | 84289 |
Sequence Information |
|
Nucleotide Sequence |
>84289 : length: 723 atggcgaccgccatgtacttggagcactatctggacagtatcgagaaccttccctgcgaa cttcagaggaacttccagctgatgcgagagctggaccagaggacggaagataagaaagca gagattgacatcctggctgcagagtacatctccacggtgaagacgctgtctccagaccag cgcgtggagcgcctgcagaagatccagaacgcctacagcaagtgcaaggaatacagtgac gacaaagtgcagctggccatgcagacctacgagatggtggataaacacattcgaaggctt gatgcagacctggcgcgctttgaagcagatctgaaggacaagatggagggcagtgatttt gaaagctccggagggcgagggttaaaaaaaggccggggtcagaaagaaaaaagagggtcc cggggccgaggcaggaggacatcagaggaagacacaccaaagaaaaagaagcacaaagga gggtctgagttcactgacaccatcctgtccgtgcacccctctgatgtgctggacatgccc gtggacccaaacgaacccacgtactgcctgtgccaccaggtctcctatggggagatgatt ggctgtgacaatccagactgtccaattgagtggtttcactttgcctgcgtggaccttacc acgaaacccaaaggaaaatggttctgtccacggtgtgtccaggaaaagaggaagaagaag tag |
Protein Sequence |
>84289 : length: 240 MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQ RVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDF ESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP VDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |