|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8431 |
Name | NR0B2 |
Synonym | SHP|SHP1;nuclear receptor subfamily 0, group B, member 2;NR0B2;nuclear receptor subfamily 0, group B, member 2 |
Definition | nuclear receptor SHP|nuclear receptor subfamily 0 group B member 2|orphan nuclear receptor SHP|small heterodimer partner |
Position | 1p36.1 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
potential | Systems-level analysis of gene expression data revealed NR0B2/SHP as potential tumor suppressor in human liver cancer. |
potential | Propose that SHP functions as a novel tumor suppressor in the development of heptaocellular carcinoma. |
potential | Small heterodimer partner plays tumor suppressor function by negatively regulating cellular growth. |
| More detail of all 3 literatures about NR0B2 | |
|
Pathways and Diseases |
|
Pathway | mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066 |
Pathway | Gene Expression;Reactome;REACT:71 |
Disease | Obesity, mild, early-onset;OMIM |
Disease | METABOLIC;GAD |
Disease | obesity;GAD |
|
External Links |
|
Links to Entrez Gene | 8431 |
Links to all GeneRIF Items | 8431 |
Links to iHOP | 8431 |
|
Sequence Information |
|
Nucleotide Sequence |
>8431 : length: 774 atgagcaccagccaaccaggggcctgcccatgccagggagctgcaagccgccccgccatt ctctacgcacttctgagctccagcctcaaggctgtcccccgaccccgtagccgctgccta tgtaggcagcaccggcccgtccagctatgtgcacctcatcgcacctgccgggaggccttg gatgttctggccaagacagtggccttcctcaggaacctgccatccttctggcagctgcct ccccaggaccagcggcggctgctgcagggttgctggggccccctcttcctgcttgggttg gcccaagatgctgtgacctttgaggtggctgaggccccggtgcccagcatactcaagaag attctgctggaggagcccagcagcagtggaggcagtggccaactgccagacagaccccag ccctccctggctgcggtgcagtggcttcaatgctgtctggagtccttctggagcctggag cttagccccaaggaatatgcctgcctgaaagggaccatcctcttcaaccccgatgtgcca ggcctccaagccgcctcccacattgggcacctgcagcaggaggctcactgggtgctgtgt gaagtcctggaaccctggtgcccagcagcccaaggccgcctgacccgtgtcctcctcacg gcctccaccctcaagtccattccgaccagcctgcttggggacctcttctttcgccctatc attggagatgttgacatcgctggccttcttggggacatgcttttgctcaggtga |
Protein Sequence |
>8431 : length: 257 MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREAL DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVP GLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPI IGDVDIAGLLGDMLLLR |