|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 84417 |
Name | C2orf40 |
Synonym | ECRG4;chromosome 2 open reading frame 40;C2orf40;chromosome 2 open reading frame 40 |
Definition | augurin|esophageal cancer related gene 4 protein|esophageal cancer-related gene 4 protein |
Position | 2q12.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 6 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Down-regulation of ECRG4, a candidate tumor suppressor gene, in human breast cancer." |
reviewed | A novel tumor suppressor gene ECRG4 interacts directly with TMPRSS11A (ECRG1) to inhibit cancer cell growth in esophageal carcinoma. |
potential | ECRG4 is a candidate tumor suppressor gene which suppressed tumor cells migration and invasion without affecting cell adhesion ability in esophageal carcinoma. |
potential | Overexpression of candidate tumor suppressor ECRG4 inhibits glioma proliferation and invasion. |
potential | ECRG4 is a candidate tumor suppressor gene frequently hypermethylated in colorectal carcinoma and glioma. |
potential | "The restoration of ECRG4 expression in ESCC cells inhibited cell proliferation, colony formation, cell cycle progression and tumor growth in vivo. ECRG4 is a novel candidate tumor suppressor gene in ESCC." |
| More detail of all 6 literatures about C2orf40 | |
|
External Links |
|
Links to Entrez Gene | 84417 |
Links to all GeneRIF Items | 84417 |
Links to iHOP | 84417 |
|
Sequence Information |
|
Nucleotide Sequence |
>84417 : length: 447 atggctgcctcccccgcgcggcctgctgtcctggccctgaccgggctggcgctgctcctg ctcctgtgctggggcccaggtggcataagtggaaataaactcaagctgatgcttcaaaaa cgagaagcacctgttccaactaagactaaagtggccgttgatgagaataaagccaaagaa ttccttggcagcctgaagcgccagaagcggcagctgtgggaccggactcggcccgaggtg cagcagtggtaccagcagtttctctacatgggctttgacgaagcgaaatttgaagatgac atcacctattggcttaacagagatcgaaatggacatgaatactatggcgattactaccaa cgtcactatgatgaagactctgcaattggtccccggagcccctacggctttaggcatgga gccagcgtcaactacgatgactactaa |
Protein Sequence |
>84417 : length: 148 MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKE FLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQ RHYDEDSAIGPRSPYGFRHGASVNYDDY |