|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 84525 |
Name | HOPX |
Synonym | CAMEO|HOD|HOP|LAGY|NECC1|OB1|SMAP31|TOTO;HOP homeobox;HOPX;HOP homeobox |
Definition | homeodomain-only protein|lung cancer-associated Y protein|not expressed in choriocarcinoma clone 1|not expressed in choriocarcinoma protein 1|odd homeobox 1 protein|odd homeobox protein 1 |
Position | 4q12 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
potential | "HOP may work as a tumor suppressor in a subset of glioblastomas; HOP function thus appears to be critical in the adult brain in a region of continued plasticity, and its deregulation may contribute to disease". |
potential | HOP is a putative tumor suppressor gene that harbors tumor inhibitory activity. |
| More detail of all 2 literatures about HOPX | |
|
Pathways and Diseases |
|
Pathway | hop pathway in cardiac development;PID BioCarta;100143 |
|
External Links |
|
Links to Entrez Gene | 84525 |
Links to all GeneRIF Items | 84525 |
Links to iHOP | 84525 |
|
Sequence Information |
|
Nucleotide Sequence |
>84525 : length: 222 atgtcggcggagaccgcgagcggccccacagaggaccaggtggaaatcctggagtacaac ttcaacaaggtcgacaagcacccggattccaccacgctgtgcctcatcgcggccgaggca ggcctttccgaggaggagacccagaaatggtttaagcagcgcctggcaaagtggcggcgc tcagaaggcctgccctcagagtgcagatccgtcacagactaa |
Protein Sequence |
>84525 : length: 73 MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRR SEGLPSECRSVTD |