|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 84651 |
Name | SPINK7 |
Synonym | ECG2|ECRG2;serine peptidase inhibitor, Kazal type 7 (putative);SPINK7;serine peptidase inhibitor, Kazal type 7 (putative) |
Definition | ECRG-2|esophagus cancer related gene 2|esophagus cancer-related gene 2 protein|esophagus cancer-related gene-2|serine protease inhibitor Kazal-type 7 |
Position | 5q32 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
potential | ECRG2 is a novel member of the Kazal-type serine protease inhibitor family and may function as a tumor suppressor gene regulating the protease cascades during carcinogenesis and invasion of esophageal cancer. |
potential | "ECRG2, a novel candidate of tumor suppressor gene in the esophageal carcinoma, interacts directly with metallothionein 2A and links to apoptosis." |
| More detail of all 2 literatures about SPINK7 | |
|
External Links |
|
Links to Entrez Gene | 84651 |
Links to all GeneRIF Items | 84651 |
Links to iHOP | 84651 |
|
Sequence Information |
|
Nucleotide Sequence |
>84651 : length: 258 atgaagatcactgggggtctccttctgctctgtacagtggtctatttctgtagcagctca gaagctgctagtctgtctccaaaaaaagtggactgcagcatttacaagaagtatccagtg gtggccatcccctgccccatcacatacctaccagtttgtggttctgactacatcacctat gggaatgaatgtcacttgtgtaccgagagcttgaaaagtaatggaagagttcagtttctt cacgatggaagttgctaa |
Protein Sequence |
>84651 : length: 85 MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY GNECHLCTESLKSNGRVQFLHDGSC |