|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 84707 |
Name | BEX2 |
Synonym | BEX1|DJ79P11.1;brain expressed X-linked 2;BEX2;brain expressed X-linked 2 |
Definition | brain-expressed X-linked protein 2|hBex2|protein BEX2 |
Position | Xq22 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "These results suggest that the conspicuous expression of the tumor suppressor genes BEX2, IGSF4 and TIMP3 in MLLmu acute myeloid leukemias cell lines is the consequence of altered epigenetic properties of MLL fusion proteins." |
potential | Genome-wide analysis of epigenetic silencing identifies BEX1 and BEX2 as candidate tumor suppressor genes in malignant glioma. |
| More detail of all 2 literatures about BEX2 | |
|
External Links |
|
Links to Entrez Gene | 84707 |
Links to all GeneRIF Items | 84707 |
Links to iHOP | 84707 |
|
Sequence Information |
|
Nucleotide Sequence |
>84707 : length: 483 atgcagaaaatggtggtttgcggggccaagtgttgcggcgacgcacctcacgtcgagaat cgggaggaggagactgcaaggataggcccaggagtaatggagtccaaagaggaacgagcg ttaaacaatctcatcgtggaaaatgtcaaccaggaaaatgatgaaaaagatgaaaaggag caagttgctaataaaggggagcccttggccctacctttgaatgttagtgaatactgtgtg cctagaggaaaccgtaggcggttccgcgttaggcagcccatcctgcagtatagatgggac ataatgcataggcttggagagccacaggcaaggatgagagaggagaatatggaaaggatt ggggaggaggtgagacagctgatggaaaagctgagggaaaagcagttgagtcatagtttg cgggcagtcagcactgatccccctcaccatgaccatcacgatgagttttgccttatgccc tga |
Protein Sequence |
>84707 : length: 160 MQKMVVCGAKCCGDAPHVENREEETARIGPGVMESKEERALNNLIVENVNQENDEKDEKE QVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERI GEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP |