|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 8572 |
Name | PDLIM4 |
Synonym | RIL;PDZ and LIM domain 4;PDLIM4;PDZ and LIM domain 4 |
Definition | LIM domain protein|LIM protein RIL|PDZ and LIM domain protein 4|enigma homolog|reversion-induced LIM protein |
Position | 5q31.1 |
Gene Type | protein-coding |
Source | Count: 2; TAG,Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
potential | "PDLIM4 may function as a tumor suppressor, involved in the control of cell proliferation by associating with actin in prostate cancer cells." |
More detail of all 1 literatures about PDLIM4 | |
External Links |
|
Links to Entrez Gene | 8572 |
Links to all GeneRIF Items | 8572 |
Links to iHOP | 8572 |
Sequence Information |
|
Nucleotide Sequence |
>8572 : length: 741 atgccccattccgtgaccctgcgcgggccttcgccctggggcttccgcctggtgggcggc cgggacttcagcgcgcccctcaccatctcacgggtccatgctggcagcaaggctgcattg gctgccctgtgcccaggagacctgatccaggccatcaatggtgagagcacagagctcatg acacacctggaggcacagaaccgcatcaagggctgccacgatcacctcacactgtctgtg agcaggcctgagggtaggagctggcccagtgcccctgatgacagcaaggctcaggcacac aggatccacatcgatcctgagatccaggacggcagcccaacaaccagcaggcggccctca ggcaccgggactgggccagaagatggcagaccaagcctgggatctccatatggacaaccc cctcgctttccagtccctcacaatggcagcagcgaggccaccctgccagcccagatgagc accctgcatgtgtctccaccccccagcgctgacccagccagaggcctcccgcggagccgg gactgcagagtcgacctgggctccgaggtgtacaggatgctgcgggagccagccgagccc gtggccgcggagcccaagcagtcaggctccttccgctacttgcagggcatgctagaggcc ggcgagggcggggcaccatcgtcaaggcacgggacaagctctaccatcccgagtgcttca tgtgcagtgactgcggcctga |
Protein Sequence |
>8572 : length: 246 MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM THLEAQNRIKGCHDHLTLSVSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPS GTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSR DCRVDLGSEVYRMLREPAEPVAAEPKQSGSFRYLQGMLEAGEGGAPSSRHGTSSTIPSAS CAVTAA |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |