|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 858 |
Name | CAV2 |
Synonym | CAV;caveolin 2;CAV2;caveolin 2 |
Definition | caveolae protein, 20-kD|caveolin 2 isoform a and b|caveolin-2 |
Position | 7q31.1 |
Gene Type | protein-coding |
Source | Count: 1; TAG |
Literature support | Count: 0 PubMed records as below. |
|
Evidence Status |
Description |
| . |
| More detail of all 0 literatures about CAV2 | |
|
Pathways and Diseases |
|
Pathway | Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100 |
Pathway | Endocytosis;KEGG PATHWAY;hsa04144 |
Pathway | Syndecan-2-mediated signaling events;PID Curated;200164 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Disease | Primary biliary cirrhosis;FunDO |
Disease | Colon cancer;FunDO |
Disease | Infection;FunDO |
Disease | Esophagus cancer;FunDO |
Disease | Skin disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 858 |
Links to all GeneRIF Items | 858 |
Links to iHOP | 858 |
|
Sequence Information |
|
Nucleotide Sequence |
>858 : length: 489 atggggctggagacggagaaggcggacgtacagctcttcatggacgacgactcctacagc caccacagcggcctcgagtacgccgaccccgagaagttcgcggactcggaccaggaccgg gatccccaccggctcaactcgcatctcaagctgggcttcgaggatgtgatcgcagagccg gtgactacgcactcctttgacaaagtgtggatctgcagccatgccctctttgaaatcagc aaatacgtaatgtacaagttcctgacggtgttcctggccattcccctggccttcattgcg ggaattctctttgccaccctcagctgtctgcacatctggattttaatgccttttgtaaag acctgcctaatggttctgccttcagtgcagacaatatggaagagtgtgacagatgttatc attgctccattgtgtacgagcgtaggacgatgcttctcttctgtcagcctgcaactgagc caggattga |
Protein Sequence |
>858 : length: 162 MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEP VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD |