|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 8848 |
Name | TSC22D1 |
Synonym | Ptg-2|TGFB1I4|TSC22;TSC22 domain family, member 1;TSC22D1;TSC22 domain family, member 1 |
Definition | TGFB-stimulated clone 22 homolog|TGFbeta-stimulated clone 22|TSC22 domain family protein 1|cerebral protein 2|regulatory protein TSC-22|transcriptional regulator TSC-22|transforming growth factor beta-1-induced transcript 4 protein|transforming growth fac |
Position | 13q14 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
Evidence Status | Description |
potential | TSC-22 is a potential tumor suppressor that is upregulated by Flt3-D835V but not Flt3-ITD. |
potential | TSC-22 normally contributes to the regulation of hematopoietic stem cell function and is a putative tumor suppressor gene that is hypermethylated and silenced in T or NK LGL leukemia. |
potential | The putative tumor suppressor Tsc-22 is downregulated early in chemically induced hepatocarcinogenesis and may be a suppressor of Gadd45b. |
| More detail of all 3 literatures about TSC22D1 | |
External Links | |
Links to Entrez Gene | 8848 |
Links to all GeneRIF Items | 8848 |
Links to iHOP | 8848 |
Sequence Information | |
Nucleotide Sequence | >8848 : length: 435 atgaaatcccaatggtgtagaccagtggcgatggatctaggagtttaccaactgagacat ttttcaatttctttcttgtcatccttgctggggactgaaaacgcttctgtgagacttgat aatagctcctctggtgcaagtgtggtagctattgacaacaaaatcgagcaagctatggat ctagtgaaaagccatttgatgtatgcggtcagagaagaagtggaggtcctcaaagagcaa atcaaagaactaatagagaaaaattcccagctggagcaggagaacaatctgctgaagaca ctggccagtcctgagcagcttgcccagtttcaggcccagctgcagactggctccccccct gccaccacccagccacagggcaccacacagccccccgcccagccagcatcgcagggctca ggaccaaccgcatag |
Protein Sequence | >8848 : length: 144 MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMD LVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPP ATTQPQGTTQPPAQPASQGSGPTA |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |