|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 90480 |
Name | GADD45GIP1 |
Synonym | CKBBP2|CRIF1|PLINP-1|PRG6|Plinp1;growth arrest and DNA-damage-inducible, gamma interacting protein 1;GADD45GIP1;growth arrest and DNA-damage-inducible, gamma interacting protein 1 |
Definition | CKII beta binding protein 2|CKII beta-associating protein|CR6 interacting factor 1|CR6-interacting factor 1|growth arrest and DNA damage-inducible proteins-interacting protein 1|p53-responsive gene 6 protein|papillomavirus L2 interacting nuclear protein 1 |
Position | 19p13.2 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status | Description |
potential | "NAC-1 contributes to tumor growth and survival by at least inhibiting Gadd45GIP1 expression, which has a tumor suppressor effect in cancer cells." |
| More detail of all 1 literatures about GADD45GIP1 | |
External Links | |
Links to Entrez Gene | 90480 |
Links to all GeneRIF Items | 90480 |
Links to iHOP | 90480 |
Sequence Information | |
Nucleotide Sequence | >90480 : length: 669 atggcggcgtccgtgcgacaggcacgcagcctactaggtgtggcggcgaccctggccccg ggttcccgtggctaccgggcgcggccgcccccgcgccgcaggccgggaccccggtggcca gaccccgaggacctcctgaccccgcggtggcagctgggaccgcgctacgcggctaagcag ttcgcgcgttacggcgccgcctccggggtggtccccggttcgttatggccgtcgccggag cagctgcgggagctggaggccgaagaacgcgaatggtacccgagcctggcgaccatgcag gagtcgctgcgggtgaagcagctggccgaagagcagaagcgtcgggagagggagcagcac atcgcagagtgcatggccaagatgccacagatgattgtgaactggcagcagcagcagcgg gagaactgggagaaggcccaggctgacaaggagaggagggcccgactgcaggctgaggcc caggagctcctgggctaccaggtggacccaaggagtgcccgcttccaggagctgctccag gacctagagaagaaggagcgcaagcgcctcaaggaggaaaaacagaaacggaagaaggag gcgcgagctgctgcattggctgcagctgtggctcaagacccagcagcctctggggcaccc agctcctga |
Protein Sequence | >90480 : length: 222 MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQ FARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQH IAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQ DLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |