|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9052 |
Name | GPRC5A |
Synonym | GPCR5A|RAI3|RAIG1;G protein-coupled receptor, family C, group 5, member A;GPRC5A;G protein-coupled receptor, family C, group 5, member A |
Definition | G-protein coupled receptor family C group 5 member A|RAIG-1|orphan G-protein-coupling receptor PEIG-1|retinoic acid induced 3|retinoic acid responsive|retinoic acid-induced gene 1 protein|retinoic acid-induced protein 3 |
Position | 12p13-p12.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "A Gprc5a tumor suppressor loss of expression signature is conserved, prevalent, and associated with survival in human lung adenocarcinomas." |
potential | Mechanisms underlying the induction of the putative human tumor suppressor GPRC5A are reported. |
potential | "Gprc5a functions as a tumor suppressor in mouse lung, and human GPRC5A may share this property." |
reviewed | Knockout of the tumor suppressor gene Gprc5a in mice leads to NF-kappaB activation in airway epithelium and promotes lung inflammation and tumorigenesis. |
| More detail of all 4 literatures about GPRC5A | |
|
External Links |
|
Links to Entrez Gene | 9052 |
Links to all GeneRIF Items | 9052 |
Links to iHOP | 9052 |
|
Sequence Information |
|
Nucleotide Sequence |
>9052 : length: 1074 atggctacaacagtccctgatggttgccgcaatggcctgaaatccaagtactacagactt tgtgataaggctgaagcttggggcatcgtcctagaaacggtggccacagccggggttgtg acctcggtggccttcatgctcactctcccgatcctcgtctgcaaggtgcaggactccaac aggcgaaaaatgctgcctactcagtttctcttcctcctgggtgtgttgggcatctttggc ctcaccttcgccttcatcatcggactggacgggagcacagggcccacacgcttcttcctc tttgggatcctcttttccatctgcttctcctgcctgctggctcatgctgtcagtctgacc aagctcgtccgggggaggaagcccctttccctgttggtgattctgggtctggccgtgggc ttcagcctagtccaggatgttatcgctattgaatatattgtcctgaccatgaataggacc aacgtcaatgtcttttctgagctttccgctcctcgtcgcaatgaagactttgtcctcctg ctcacctacgtcctcttcttgatggcgctgaccttcctcatgtcctccttcaccttctgt ggttccttcacgggctggaagagacatggggcccacatctacctcacgatgctcctctcc attgccatctgggtggcctggatcaccctgctcatgcttcctgactttgaccgcaggtgg gatgacaccatcctcagctccgccttggctgccaatggctgggtgttcctgttggcttat gttagtcccgagttttggctgctcacaaagcaacgaaaccccatggattatcctgttgag gatgctttctgtaaacctcaactcgtgaagaagagctatggtgtggagaacagagcctac tctcaagaggaaatcactcaaggttttgaagagacaggggacacgctctatgccccctat tccacacattttcagctgcagaaccagcctccccaaaaggaattctccatcccacgggcc cacgcttggccgagcccttacaaagactatgaagtaaagaaagagggcagctaa |
Protein Sequence |
>9052 : length: 357 MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSN RRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLT KLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLL LTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRW DDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAY SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS |