|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 9077 |
Name | DIRAS3 |
Synonym | ARHI|NOEY2;DIRAS family, GTP-binding RAS-like 3;DIRAS3;DIRAS family, GTP-binding RAS-like 3 |
Definition | GTP-binding protein Di-Ras3|distinct subgroup of the Ras family member 3|ras homolog gene family, member I|rho-related GTP-binding protein RhoI |
Position | 1p31 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 11 PubMed records as below. |
Evidence Status | Description |
potential | "NOEY2 (ARHI), an imprinted putative tumor suppressor gene in ovarian and breast carcinomas." |
reviewed | The tumor-suppressor gene ARHI (DIRAS3) suppresses ovarian cancer cell migration through inhibition of the Stat3 and FAK/Rho signaling pathways. |
reviewed | Expression of the tumor suppressor ARHI inhibits the growth of pancreatic cancer cells by inducing G1 cell cycle arrest. |
reviewed | The tumor suppressor gene ARHI regulates autophagy and tumor dormancy in human ovarian cancer cells. |
potential | "provide evidences that ARHI downregulated in HCCs could play a role in liver cancer via acting as a tumor suppressor gene, which mainly was triggered by the epigenetic events in HCC specimens". |
reviewed | Imprinted tumor suppressor genes ARHI and PEG3 are the most frequently down-regulated in human ovarian cancers by loss of heterozygosity and promoter methylation. |
reviewed | E2F-HDAC complexes negatively regulate the tumor suppressor gene ARHI in breast cancer. |
potential | Association between STAT3 and ARHI as well as the functional inhibition of STAT3 transcriptional activity by ARHI suggests a novel mechanism through which a putative tumor suppressor gene can inhibit STAT3 activity in breast and ovarian cancers. |
reviewed | Loss of the expression of the tumor suppressor gene ARHI is associated with progression of breast cancer. |
reviewed | "Aberrant methylation and silencing of ARHI, an imprinted tumor suppressor gene in which the function is lost in breast cancers." |
| More detail of all 11 literatures about DIRAS3 | |
External Links | |
Links to Entrez Gene | 9077 |
Links to all GeneRIF Items | 9077 |
Links to iHOP | 9077 |
Sequence Information | |
Nucleotide Sequence | >9077 : length: 690 atgggtaacgccagctttggctccaaggaacagaagctgctgaagcggttgcggcttctg cccgccctgcttatcctccgcgccttcaagccccacaggaagatcagagattaccgcgtc gtggtagtcggcaccgctggtgtggggaaaagtacgctgctgcacaagtgggcgagcggc aacttccgtcatgagtacctgccgaccattgaaaatacctactgccagttgctgggctgc agccacggtgtgctttccctgcacatcaccgacagcaagagtggcgacggcaaccgcgct ctgcagcgccacgttatagcccggggccacgccttcgtcctggtctactcagtcaccaag aaggaaaccctggaagagctgaaggccttctatgagctgatctgcaagatcaaaggtaac aacctgcataagttccccatcgtgctggtgggcaataaaagtgatgacacccaccgggag gtggccctgaatgatggtgccacctgtgcgatggagtggaattgcgccttcatggagatt tcagccaagaccgatgtgaatgtgcaggagctgttccacatgctgctgaattacaagaaa aagcccaccaccggcctccaggagcccgagaagaaatcccagatgcccaacaccactgag aagctgcttgacaagtgcataatcatgtga |
Protein Sequence | >9077 : length: 229 MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASG NFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTK KETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEI SAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |