|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 92304 |
Name | SCGB3A1 |
Synonym | HIN-1|HIN1|LU105|PnSP-2|UGRP2;secretoglobin, family 3A, member 1;SCGB3A1;secretoglobin, family 3A, member 1 |
Definition | cytokine HIN-1|cytokine high in normal-1|high in normal 1|pneumo secretory protein 2|secretoglobin family 3A member 1|uteroglobin-related protein 2 |
Position | 5q35-qter |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | The epigenetic silencing of tumor suppressor genes involved in the Ras/PI3K/AKT pathway plays an important role in oral squamous cell carcinoma radioresistance. |
potential | "Studies provide further evidence that HIN-1 possesses tumor suppressor functions, and that these activities may be mediated through the AKT signaling pathway." |
| More detail of all 2 literatures about SCGB3A1 | |
|
External Links |
|
Links to Entrez Gene | 92304 |
Links to all GeneRIF Items | 92304 |
Links to iHOP | 92304 |
|
Sequence Information |
|
Nucleotide Sequence |
>92304 : length: 315 atgaagctcgccgccctcctggggctctgcgtggccctgtcctgcagctccgctgctgct ttcttagtgggctcggccaagcctgtggcccagcctgtcgctgcgctggagtcggcggcg gaggccggggccgggaccctggccaaccccctcggcaccctcaacccgctgaagctcctg ctgagcagcctgggcatccccgtgaaccacctcatagagggctcccagaagtgtgtggct gagctgggtccccaggccgtgggggccgtgaaggccctgaaggccctgctgggggccctg acagtgtttggctga |
Protein Sequence |
>92304 : length: 104 MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLL LSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG |