|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 94241 |
Name | TP53INP1 |
Synonym | SIP|TP53DINP1|TP53INP1A|TP53INP1B|Teap|p53DINP1;tumor protein p53 inducible nuclear protein 1;TP53INP1;tumor protein p53 inducible nuclear protein 1 |
Definition | p53-dependent damage-inducible nuclear protein 1|p53-inducible p53DINP1|stress-induced protein|tumor protein p53-inducible nuclear protein 1 |
Position | 8q22 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | This novel TP53INP1 activity on the regulation of SPARC expression could explain in part its tumor suppressor function in pancreatic adenocarcinoma by modulating cellular spreading during the metastatic process. |
reviewed | TP53INP1 is a tumor suppressor in esophageal squamous cell carcinoma (ESCC0; c-Myc-mediated DNA methylation-associated silencing of TP53INP1 contributed to the pathogenesis of human ESCC. |
reviewed | "Roles for microRNAs, miR-93 and miR-130b, and tumor protein 53-induced nuclear protein 1 tumor suppressor in cell growth dysregulation by human T-cell lymphotrophic virus 1." |
reviewed | Absence of tumor suppressor tumor protein 53-induced nuclear protein 1 (TP53INP1) sensitizes mouse thymocytes and embryonic fibroblasts to redox-driven apoptosis. |
| More detail of all 4 literatures about TP53INP1 | |
|
Pathways and Diseases |
|
Pathway | Direct p53 effectors;PID Curated;200101 |
Disease | Type 2 diabetes;NHGRI |
|
External Links |
|
Links to Entrez Gene | 94241 |
Links to all GeneRIF Items | 94241 |
Links to iHOP | 94241 |
|
Sequence Information |
|
Nucleotide Sequence |
>94241 : length: 495 atgttccagaggctgaataaaatgtttgtgggtgaagtcagttcttcctccaaccaagaa ccagaattcaatgagaaagaagatgatgaatggattcttgttgacttcatagatacttgc actggtttctcagcagaagaagaagaagaagaggaggacatcagtgaagagtcacctact gagcacccttcagtcttttcctgtttaccggcatctcttgagtgcttggctgatacaagt gattcctgctttctccagtttgagtcatgtccaatggaggagagctggtttatcacccca cccccatgttttactgcaggtggattaaccactatcaaggtggaaacaagtcctatggaa aaccttctcattgaacatcccagcatgtctgtctatgctgtgcataactcctgccctggt ctcagtgaggccacccgtgggactgatgaattacatagcccaagtagtcccagggccagg aaaagctgcttataa |
Protein Sequence |
>94241 : length: 164 MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPT EHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPME NLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRARKSCL |