|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 9516 |
Name | LITAF |
Synonym | PIG7|SIMPLE|TP53I7;lipopolysaccharide-induced TNF factor;LITAF;lipopolysaccharide-induced TNF factor |
Definition | LPS-induced TNF-alpha factor|lipopolysaccharide-induced TNF-alpha factor|lipopolysaccharide-induced tumor necrosis factor-alpha factor|p53-induced gene 7 protein|small integral membrane protein of lysosome/late endosome|tumor protein p53 inducible protein |
Position | 16p13.13 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status | Description |
potential | studies for the first time establish the regulatory axis of AMPK-LITAF-TNFSF15 and also suggest that LITAF may function as a tumor suppressor. |
| More detail of all 1 literatures about LITAF | |
External Links | |
Links to Entrez Gene | 9516 |
Links to all GeneRIF Items | 9516 |
Links to iHOP | 9516 |
Sequence Information | |
Nucleotide Sequence | >9516 : length: 486 atgtcggttccaggaccttaccaggcggccactgggccttcctcagcaccatccgcacct ccatcctatgaagagacagtggctgttaacagttattaccccacacctccagctcccatg cctgggccaactacggggcttgtgacggggcctgatgggaagggcatgaatcctccttcg tattatacccagccagcgcccatccccaataacaatccaattaccgtgcagacggtctac gtgcagcaccccatcacctttttggaccgccctatccaaatgtgttgtccttcctgcaac aagatgatcgtgagtcagctgtcctataacgccggtgctctgacctggctgtcctgcggg agcctgtgcctgctggggtgcatagcgggctgctgcttcatccccttctgcgtggatgcc ctgcaggacgtggaccattactgtcccaactgcagagctctcctgggcacctacaagcgt ttgtag |
Protein Sequence | >9516 : length: 161 MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPS YYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCG SLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |