|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9521 |
Name | EEF1E1 |
Synonym | AIMP3|P18;eukaryotic translation elongation factor 1 epsilon 1;EEF1E1;eukaryotic translation elongation factor 1 epsilon 1 |
Definition | ARS-interacting multifunctional protein 3|aminoacyl tRNA synthetase complex-interacting multifunctional protein 3|eukaryotic translation elongation factor 1 epsilon-1|multisynthase complex auxiliary component p18|p18 component of aminoacyl-tRNA synthetase |
Position | 6p24.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 6 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Dual role of methionyl-tRNA synthetase in the regulation of translation and tumor suppressor activity of aminoacyl-tRNA synthetase-interacting multifunctional protein-3. |
reviewed | Decreased expression of AIMP3 in gastric and colorectal cancer tissues suggests that down-regulation of this protein may be related to inactivation of the tumor suppressor functions of AIMP proteins and might play a role in the development of GC and CRC. |
reviewed | "Absence of somatic mutation of a tumor suppressor gene eukaryotic translation elongation factor 1, epsilon-1 (EEF1E1), in common human cancers." |
reviewed | analysis of the three-dimensional structure and residues of the novel tumor suppressor AIMP3/p18 required for the interaction with. |
reviewed | p18 is a haploinsufficient tumor suppressor and a key factor for ATM/ATR-mediated p53 activation. |
reviewed | Downregulation of lamin A by tumor suppressor AIMP3/p18 leads to a progeroid phenotype in mice. |
| More detail of all 6 literatures about EEF1E1 | |
|
Pathways and Diseases |
|
Pathway | Cytosolic tRNA aminoacylation;PID Reactome;500660 |
Pathway | Gene Expression;Reactome;REACT:71 |
|
External Links |
|
Links to Entrez Gene | 9521 |
Links to all GeneRIF Items | 9521 |
Links to iHOP | 9521 |
|
Sequence Information |
|
Nucleotide Sequence |
>9521 : length: 420 atggcggcggccgcagagttgtcgctactggagaagtccctgggactgagtaaggggaat aaatacagtgctcagggcgagcgacagattccagttcttcagacaaacaatggtccaagt ctaacaggattgactactatagcagctcatctagtcaagcaagccaacaaagaatatttg ctggggagtactgcagaagaaaaagcaatcgttcagcagtggttagaatacagggtcact caagtagatgggcactccagtaaaaatgacatccacacactgttgaaggatcttaattca tatcttgaagataaagtctaccttacagggtataactttacattagcagatatactattg tactatggacttcatcgctttataataaggaagctgaggcacacagaggtagggaactaa |
Protein Sequence |
>9521 : length: 139 MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYL LGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILL YYGLHRFIIRKLRHTEVGN |