|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9538 |
Name | EI24 |
Synonym | EPG4|PIG8|TP53I8;etoposide induced 2.4 mRNA;EI24;etoposide induced 2.4 mRNA |
Definition | ectopic P-granules autophagy protein 4 homolog|etoposide-induced protein 2.4 homolog|p53-induced gene 8 protein|tumor protein p53 inducible protein 8 |
Position | 11q24 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
potential | Loss of putative tumor suppressor EI24/PIG8 confers resistance to etoposide. |
potential | "Our data represent the first evidence of alterations in the PIG8 gene in human malignancies, a finding that substantiates its role as a potential tumour suppressor gene as suggested by its involvement in p53-induced apoptosis." |
| More detail of all 2 literatures about EI24 | |
|
Pathways and Diseases |
|
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
|
External Links |
|
Links to Entrez Gene | 9538 |
Links to all GeneRIF Items | 9538 |
Links to iHOP | 9538 |
|
Sequence Information |
|
Nucleotide Sequence |
>9538 : length: 789 atggctgacagtgtcaaaacctttctccaggaccttgccagaggaatcaaagactccatc tggggtatttgtaccatctcaaagctagatgctcgaatccagcaaaagagagaggagcag cgtcgaagaagggcaagtagtgtcttggcacagagaagagcccagagtatagagcggaag caagagagtgagccacgtattgttagtagaattttccagtgttgtgcttggaatggtgga gtgttctggttcagtctcctcttgttttatcgagtatttattcctgtgcttcagtcggta acagcccgaattatcggtgacccatcactacatggagatgtttggtcgtggctggaattc ttcctcacgtcaattttcagtgctctttgggtgctccccttgtttgtgcttagcaaagtg gtgaatgccatttggtttcaggatatagctgacctggcatttgaggtatcagggaggaag cctcacccattccctagtgtcagcaaaataattgctgacatgctcttcaaccttttgctg caggctcttttcctcattcagggaatgtttgtgagtctctttcccatccatcttgtcggt cagctggttagtctcctgcatatgtcccttctctactcactgtactgctttgaatatcgt tggttcaataaagtggctgccttttctctatcctctttcctttattcattatcagcgcca atgaagcaaagacccctggcaaagcatatctcttccagttgcgcctcttctccttggtgg tcttcttaa |
Protein Sequence |
>9538 : length: 262 MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERK QESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEF FLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL QALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKVAAFSLSSFLYSLSAP MKQRPLAKHISSSCASSPWWSS |