|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 9770 |
Name | RASSF2 |
Synonym | CENP-34|RASFADIN;Ras association (RalGDS/AF-6) domain family member 2;RASSF2;Ras association (RalGDS/AF-6) domain family member 2 |
Definition | Ras association (RalGDS/AF-6) domain family 2|centromere protein 34|ras association domain-containing protein 2 |
Position | 20p13 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 7 PubMed records as below. |
Evidence Status | Description |
potential | Results suggest that RASSF2 encodes a novel epigenetically inactivated candidate tumor suppressor gene in thyroid carcinogenesis. |
reviewed | Role of the tumor suppressor RASSF2 in regulation of MST1 kinase activity. |
reviewed | "Extracellular signal-regulated kinase 2 (ERK-2) mediated phosphorylation regulates nucleo-cytoplasmic shuttling and cell growth control of Ras-associated tumor suppressor protein, RASSF2." |
reviewed | The epigenetic silencing of tumor suppressor genes involved in the Ras/PI3K/AKT pathway plays an important role in oral squamous cell carcinoma radioresistance. |
reviewed | Nuclear transport of Ras-associated tumor suppressor proteins: different transport receptor binding specificities for arginine-rich nuclear targeting signals. |
reviewed | RASSF2 is a novel tumor suppressor gene that regulates Ras signaling and plays a pivotal role in the early stages of colorectal tumorigenesis. |
reviewed | RASSF2 is a new member of the RASSF1 family of Ras effectors/tumor suppressors that exhibits a specificity for interacting with K-Ras. |
| More detail of all 7 literatures about RASSF2 | |
External Links | |
Links to Entrez Gene | 9770 |
Links to all GeneRIF Items | 9770 |
Links to iHOP | 9770 |
Sequence Information | |
Nucleotide Sequence | >9770 : length: 981 atggactacagccaccaaacgtccctagtcccatgtggacaagataaatacatttccaaa aatgaacttctcttgcatctgaagacctacaacttgtactatgaaggccagaatttacag ctccggcaccgggaggaagaagacgagttcattgtggaggggctcctgaacatctcctgg ggcctgcgccggcccattcgcctgcagatgcaggatgacaacgaacgcattcgaccccct ccatcctcctcctcctggcactctggctgtaacctgggggctcagggaaccactctgaag cccctgactgtgcccaaagttcagatctcagaggtggatgccccgccggagggtgaccag atgccaagctccacagactccaggggcctgaagcccctgcaggaggacaccccacagctg atgcgcacacgcagtgatgttggggtgcgtcgccgtggcaatgtgaggacgcctagtgac cagcggcgaatcagacgccaccgcttctccatcaacggccatttctacaaccataagaca tccgtgttcacaccagcctatggctctgtcaccaacgtccgcatcaacagcaccatgacc accccacaggtcctgaagctgctgctcaacaaatttaagattgagaattcagcagaggag tttgccttgtacgtggtccatacgagtggtgagaaacagaagctgaaggccaccgattac ccgctgattgcccgaatcctccagggcccatgtgagcagatctccaaagtgttcctaatg gagaaggaccaggtggaggaagtcacctacgacgtggcccagtatataaagttcgagatg ccggtacttaaaagcttcattcagaagctccaggaggaagaagatcgggaagtaaagaag ctgatgcgcaagtacaccgtgctccggctaatgattcgacagaggctggaggagatagcc gagaccccagcaacaatctga |
Protein Sequence | >9770 : length: 326 MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISW GLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ MPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKT SVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDY PLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK LMRKYTVLRLMIRQRLEEIAETPATI |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |