| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1634 |
Name | DCN |
Synonym | CSCD|DSPG2|PG40|PGII|PGS2|SLRR1B;decorin;DCN;decorin |
Definition | PG-S2|bone proteoglycan II|decorin proteoglycan|dermatan sulphate proteoglycans II|proteoglycan core protein|small leucine-rich protein 1B |
Position | 12q21.33 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 5758 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Disease | Pre-Eclampsia;FunDO |
Disease | Embryoma;FunDO |
Disease | IMMUNE;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | diabetes, type 1;GAD |
Disease | Thyroid cancer;FunDO |
Disease | Skin disease, Genetic;FunDO |
Disease | Corneal dystrophy, congenital stromal;OMIM |
Disease | Osteosarcoma;FunDO |
Disease | renal disease;GAD |
Disease | Ptosis;FunDO |
Disease | Oral cancer;FunDO |
Disease | Malignant glioma;FunDO |
Disease | Vascular disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 1634 |
Links to all GeneRIF Items | 1634 |
Links to iHOP | 1634 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>1634 : length: 1080 atgaaggccactatcatcctccttctgcttgcacaagtttcctgggctggaccgtttcaa cagagaggcttatttgactttatgctagaagatgaggcttctgggataggcccagaagtt cctgatgaccgcgacttcgagccctccctaggcccagtgtgccccttccgctgtcaatgc catcttcgagtggtccagtgttctgatttgggtctggacaaagtgccaaaggatcttccc cctgacacaactctgctagacctgcaaaacaacaaaataaccgaaatcaaagatggagac tttaagaacctgaagaaccttcacgcattgattcttgtcaacaataaaattagcaaagtt agtcctggagcatttacacctttggtgaagttggaacgactttatctgtccaagaatcag ctgaaggaattgccagaaaaaatgcccaaaactcttcaggagctgcgtgcccatgagaat gagatcaccaaagtgcgaaaagttactttcaatggactgaaccagatgattgtcatagaa ctgggcaccaatccgctgaagagctcaggaattgaaaatggggctttccagggaatgaag aagctctcctacatccgcattgctgataccaatatcaccagcattcctcaaggtcttcct ccttcccttacggaattacatcttgatggcaacaaaatcagcagagttgatgcagctagc ctgaaaggactgaataatttggctaagttgggattgagtttcaacagcatctctgctgtt gacaatggctctctggccaacacgcctcatctgagggagcttcacttggacaacaacaag cttaccagagtacctggtgggctggcagagcataagtacatccaggttgtctaccttcat aacaacaatatctctgtagttggatcaagtgacttctgcccacctggacacaacaccaaa aaggcttcttattcgggtgtgagtcttttcagcaacccggtccagtactgggagatacag ccatccaccttcagatgtgtctacgtgcgctctgccattcaactcggaaactataagtaa |
Protein Sequence |
>1634 : length: 359 MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKV SPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIE LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAAS LKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK |