| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3479 |
Name | IGF1 |
Synonym | IGF-I|IGF1A|IGFI;insulin-like growth factor 1 (somatomedin C);IGF1;insulin-like growth factor 1 (somatomedin C) |
Definition | IGF-IA|IGF-IB|MGF|insulin-like growth factor I|insulin-like growth factor IA|insulin-like growth factor IB|mechano growth factor|somatomedin-C |
Position | 12q23.2 |
Gene Type | protein-coding |
TSG scores | Description |
| TUSON ranking | 8795 |
TUSON P-value | 1 |
Pathways and Diseases | |
Pathway | multiple antiapoptotic pathways from igf-1r signaling lead to bad phosphorylation;PID BioCarta;100135 |
Pathway | Diabetes pathways;Reactome;REACT:15380 |
Pathway | Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade;PANTHER;P00032 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410 |
Pathway | igf-1 signaling pathway;PID BioCarta;100136 |
Pathway | Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960 |
Pathway | Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914 |
Pathway | the igf-1 receptor and longevity;PID BioCarta;100115 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033 |
Pathway | mTOR signaling pathway;KEGG PATHWAY;hsa04150 |
Pathway | skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137 |
Pathway | Melanoma;KEGG PATHWAY;hsa05218 |
Pathway | Glioma;KEGG PATHWAY;hsa05214 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | regulation of bad phosphorylation;PID BioCarta;100233 |
Pathway | Dilated cardiomyopathy;KEGG PATHWAY;hsa05414 |
Pathway | Long-term depression;KEGG PATHWAY;hsa04730 |
Pathway | Oocyte meiosis;KEGG PATHWAY;hsa04114 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | Synthesis, Secretion, and Deacylation of Ghrelin;PID Reactome;500141 |
Disease | Cardiovascular disease;FunDO |
Disease | Growth retardation;FunDO |
Disease | Subarachnoid Hemorrhage;GAD |
Disease | triglycerides;GAD |
Disease | DEVELOPMENTAL;GAD |
Disease | IMMUNE;GAD |
Disease | Alopecia;FunDO |
Disease | Hyperthyroidism;FunDO |
Disease | Colon cancer;FunDO |
Disease | Cervical cancer;FunDO |
Disease | microalbuminuria;GAD |
Disease | Renal Cell cancer;FunDO |
Disease | Insulin-like growth factor-3;GAD |
Disease | IGFBP-3 levels;GAD |
Disease | fasting insulin-related traits;GAD |
Disease | Birth Weight;GAD |
Disease | height;GAD |
Disease | Cerebral palsy;FunDO |
Disease | body height;GAD |
Disease | cirrhosis, primary biliary;GAD |
Disease | Osteoporosis;GAD |
Disease | Osteosarcoma;FunDO |
Disease | Antiphospholipid syndrome;FunDO |
Disease | insulin-like growth factor;GAD |
Disease | Lung cancer;FunDO |
Disease | Fasting insulin-related traits;NHGRI |
Disease | Liver cancer;FunDO |
Disease | cardiovascular disease;GAD |
Disease | prostate cancer;GAD |
Disease | Cirrhosis;FunDO |
Disease | insulin-like growth factor-1;GAD |
Disease | bone density fractures, vertebral;GAD |
Disease | Solid tumor;FunDO |
Disease | lymphocyte subset counts in neonates;GAD |
Disease | Fibromyalgia;FunDO |
Disease | Osteoporosis;FunDO |
Disease | Endocrine system disease;FunDO |
Disease | Height;NHGRI |
Disease | Primary tumor;FunDO |
Disease | fasting glucose-related traits;GAD |
Disease | small for gestational age;GAD |
Disease | Hyperglycemia;FunDO |
Disease | Esophagus cancer;FunDO |
Disease | prostatic hyperplasia;GAD |
Disease | Prostate cancer;FunDO |
Disease | IGF-I levels;GAD |
Disease | Polycystic kidney;FunDO |
Disease | Leukemia;FunDO |
Disease | METABOLIC;GAD |
Disease | Growth retardation with deafness and mental retardation due to IGF1 deficiency;OMIM |
Disease | Schizophrenia;FunDO |
Disease | retinopathy, diabetic;GAD |
Disease | Malignant pleural mesothelioma;KEGG DISEASE;H00015 |
Disease | colorectal cancer;GAD |
Disease | estrogen metabolism;GAD |
Disease | diabetes, type 2;GAD |
Disease | Fibroid tumor;FunDO |
Disease | Fasting glucose-related traits;NHGRI |
Disease | CARDIOVASCULAR;GAD |
Disease | myocardial infarct, mortality in;GAD |
Disease | Late pregnancy;FunDO |
Disease | Spinal cord disease;FunDO |
Disease | Polycythemia;FunDO |
Disease | Sickle cell disease;FunDO |
Disease | REPRODUCTION;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | postnatal growth;GAD |
Disease | breast cancer;GAD |
Disease | Obesity;FunDO |
Disease | Advanced cancer;FunDO |
Disease | Folic acid deficiency;FunDO |
Disease | Protein-energy malnutrition;FunDO |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | Hepatitis C;FunDO |
Disease | IGF-I;GAD |
Disease | Laron-type dwarfism;GAD |
Disease | Breast cancer;FunDO |
Disease | Esotropia;FunDO |
Disease | Embryoma;FunDO |
Disease | VISION;GAD |
Disease | Pulmonary fibrosis;FunDO |
Disease | Liver disease;FunDO |
Disease | primary biliary cirrhosis];GAD |
Disease | Alzheimer's disease;FunDO |
Disease | Bone Mineral Density;GAD |
Disease | Thalassemia;FunDO |
Disease | CANCER;GAD |
Disease | Myocardial Infarction;GAD |
Disease | Weight Gain;GAD |
Disease | Endometriosis;FunDO |
Disease | mamographic density;GAD |
Disease | Gastrointestinal stromal tumor;FunDO |
Disease | Hypothyroidism;FunDO |
Disease | Heart failure;FunDO |
Disease | Bone disease;FunDO |
Disease | Testicular dysfunction;FunDO |
Disease | Acromegaly;FunDO |
External Links | |
Links to Entrez Gene | 3479 |
Links to all GeneRIF Items | 3479 |
Links to iHOP | 3479 |
Sequence Information | The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence | >3479 : length: 462 atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcgctgtgcctgctc accttcaccagctctgccacggctggaccggagacgctctgcggggctgagctggtggat gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt gatctaaggaggctggagatgtattgcgcacccctcaagcctgccaagtcagctcgctct gtccgtgcccagcgccacaccgacatgcccaagacccagaaggaagtacatttgaagaac gcaagtagagggagtgcaggaaacaagaactacaggatgtag |
Protein Sequence | >3479 : length: 153 MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS VRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM |