| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4494 |
Name | MT1F |
Synonym | MT1;metallothionein 1F;MT1F;metallothionein 1F |
Definition | MT-1F|MT-IF|metallothionein 1F (functional)|metallothionein-1F|metallothionein-IF |
Position | 16q13 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 10889 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 4494 |
Links to all GeneRIF Items | 4494 |
Links to iHOP | 4494 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>4494 : length: 186 atggaccccaactgctcctgcgccgctggtgtctcctgcacctgcgctggttcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtagcaagtgtgcccagggctgtgtttgcaaaggggcgtcagagaagtgcagctgctgc gactga |
Protein Sequence |
>4494 : length: 61 MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCC D |