| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5074 |
Name | PAWR |
Synonym | PAR4|Par-4;PRKC, apoptosis, WT1, regulator;PAWR;PRKC, apoptosis, WT1, regulator |
Definition | PRKC apoptosis WT1 regulator protein|WT1-interacting protein|prostate apoptosis response 4 protein|prostate apoptosis response protein 4|prostate apoptosis response protein PAR-4|prostate apoptosis response-4|transcriptional repressor PAR4 |
Position | 12q21 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 310 |
TUSON P-value | 0.003091928 |
|
Pathways and Diseases |
|
Pathway | Coregulation of Androgen receptor activity;PID Curated;200038 |
Pathway | Ceramide signaling pathway;PID Curated;200100 |
Disease | Neuroblastoma;FunDO |
Disease | PSYCH;GAD |
Disease | Attention deficit hyperactivity disorder and conduct disorder;NHGRI |
Disease | Attention deficit hyperactivity disorder and conduct disorder;GAD |
Disease | Psychotic disorder;FunDO |
Disease | Lung cancer;FunDO |
Disease | Nasopharyngeal cancer;FunDO |
Disease | Pancreas cancer;FunDO |
Disease | Leukoencephalopathy;FunDO |
Disease | Bipolar disorder;FunDO |
|
External Links |
|
Links to Entrez Gene | 5074 |
Links to all GeneRIF Items | 5074 |
Links to iHOP | 5074 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5074 : length: 1023 atggcgaccggtggctaccggaccagcagcggcctcggcggcagcaccacagacttcctg gaggagtggaaggcgaaacgcgagaagatgcgcgccaagcagaaccccccgggcccggcc cccccgggagggggcagcagcgacgccgctgggaagccccccgcgggggctctgggcacc ccggcggccgccgctgccaacgagctcaacaacaacctcccgggcggcgcgccggccgca cctgccgtccccggtcccgggggcgtgaactgcgcggtcggctccgccatgctgacgcgg gcggcccccggcccgcggcggtcggaggacgagcccccagccgcctctgcctcggctgca ccgccgccccagcgtgacgaggaggagccggacggcgtcccagagaagggcaagagctcg ggccccagtgccaggaaaggcaaggggcagatcgagaagaggaagctgcgggagaagcgg cgctccaccggcgtggtcaacatccctgccgcagagtgcttagatgagtacgaagatgat gaagcagggcagaaagagcggaaacgagaagatgcaattacacaacagaacactattcag aatgaagctgtaaacttactagatccaggcagttcctatctgctacaggagccacctaga acagtttcaggcagatataaaagcacaaccagtgtctctgaagaagatgtctcaagtaga tattctcgaacagatagaagtgggttccctagatataacagggatgcaaatgtttcaggt actctggtttcaagtagcacactggaaaagaaaattgaagatcttgaaaaggaagtagta agagaaagacaagaaaacctaagacttgtgagactgatgcaagataaagaggaaatgatt ggaaaactcaaagaagaaattgatttattaaatagagacctagatgacatagaagatgaa aatgaacagctaaagcaggaaaataaaactcttttgaaagttgtgggtcagctgaccagg tag |
Protein Sequence |
>5074 : length: 340 MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGT PAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAA PPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDD EAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSR YSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI GKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR |