| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5300 |
Name | PIN1 |
Synonym | DOD|UBL5;peptidylprolyl cis/trans isomerase, NIMA-interacting 1;PIN1;peptidylprolyl cis/trans isomerase, NIMA-interacting 1 |
Definition | PPIase Pin1|peptidyl-prolyl cis-trans isomerase NIMA-interacting 1|protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1|rotamase Pin1 |
Position | 19p13 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 12808 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622 |
Pathway | p53 pathway;PID Curated;200175 |
Pathway | C-MYC pathway;PID Curated;200093 |
Disease | Embryoma;FunDO |
Disease | Neuroblastoma;FunDO |
Disease | Squamous cell cancer;FunDO |
Disease | Neurodegenerative disorder;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Alzheimer's disease;GAD |
Disease | breast cancer;GAD |
Disease | CANCER;GAD |
Disease | Dental plaque;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | Breast cancer;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Liver cancer;FunDO |
Disease | Adenoid cystic cancer;FunDO |
Disease | Brain disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 5300 |
Links to all GeneRIF Items | 5300 |
Links to iHOP | 5300 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5300 : length: 492 atggcggacgaggagaagctgccgcccggctgggagaagcgcatgagccgcagctcaggc cgagtgtactacttcaaccacatcactaacgccagccagtgggagcggcccagcggcaac agcagcagtggtggcaaaaacgggcagggggagcctgccagggtccgctgctcgcacctg ctggtgaagcacagccagtcacggcggccctcgtcctggcggcaggagaagatcacccgg accaaggaggaggccctggagctgatcaacggctacatccagaagatcaagtcgggagag gaggactttgagtctctggcctcacagttcagcgactgcagctcagccaaggccagggga gacctgggtgccttcagcagaggtcagatgcagaagccatttgaagacgcctcgtttgcg ctgcggacgggggagatgagcgggcccgtgttcacggattccggcatccacatcatcctc cgcactgagtga |
Protein Sequence |
>5300 : length: 163 MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |