| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6282 |
Name | S100A11 |
Synonym | HEL-S-43|MLN70|S100C;S100 calcium binding protein A11;S100A11;S100 calcium binding protein A11 |
Definition | MLN 70|S100 calcium-binding protein A11 (calgizzarin)|calgizzarin|epididymis secretory protein Li 43|metastatic lymph node gene 70 protein|protein S100-A11|protein S100-C |
Position | 1q21 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 14476 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 6282 |
Links to all GeneRIF Items | 6282 |
Links to iHOP | 6282 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>6282 : length: 318 atggcaaaaatctccagccctacagagactgagcggtgcatcgagtccctgattgctgtc ttccagaagtatgctggaaaggatggttataactacactctctccaagacagagttccta agcttcatgaatacagaactagctgccttcacaaagaaccagaaggaccctggtgtcctt gaccgcatgatgaagaaactggacaccaacagtgatggtcagctagatttctcagaattt cttaatctgattggtggcctagctatggcttgccatgactccttcctcaaggctgtccct tcccagaagcggacctga |
Protein Sequence |
>6282 : length: 105 MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL DRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT |