| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7428 |
Name | VHL |
Synonym | HRCA1|RCA1|VHL1|pVHL;von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase;VHL;von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase |
Definition | elongin binding protein|protein G7|von Hippel-Lindau disease tumor suppressor |
Position | 3p25.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 8 |
TUSON P-value | 4.27E-62 |
|
Pathways and Diseases |
|
Pathway | Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161 |
Pathway | Hypoxia response via HIF activation;PANTHER;P00030 |
Pathway | Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120 |
Pathway | hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145 |
Pathway | vegf hypoxia and angiogenesis;PID BioCarta;100006 |
Pathway | Hypoxic and oxygen homeostasis regulation of HIF-1-alpha;PID Curated;200122 |
Pathway | HIF-2-alpha transcription factor network;PID Curated;200030 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Renal cell carcinoma;KEGG PATHWAY;hsa05211 |
Disease | Ischemia;FunDO |
Disease | Hematologic diseases;KEGG DISEASE |
Disease | Polycythemia, benign familial;OMIM |
Disease | non-papillary renal cell carcinomas;GAD |
Disease | Congenital polycythemia;KEGG DISEASE;H00236 |
Disease | Hemangioblastoma, cerebellar, somatic;OMIM |
Disease | retinal hemangioblastomas;GAD |
Disease | Renal cell carcinoma, somatic;OMIM |
Disease | Cancer;FunDO |
Disease | Oral cancer;FunDO |
Disease | Circulatory system diseases;KEGG DISEASE |
Disease | VISION;GAD |
Disease | von Hippel-Lindau syndrome;OMIM |
Disease | Pheochromocytoma;OMIM |
Disease | Vascular disease;FunDO |
Disease | Epilepsy;FunDO |
Disease | von Hippel-Lindau syndrome (VHL).;GAD |
Disease | CANCER;GAD |
Disease | Rabies;FunDO |
Disease | Polycythemia;FunDO |
Disease | renal cancer;GAD |
Disease | Renal cell carcinoma;KEGG DISEASE;H00021 |
Disease | Cancers;KEGG DISEASE |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | renal cell carcinoma;GAD |
Disease | germline mutations;GAD |
Disease | von Hippel-Lindau type 2A;GAD |
Disease | Congenital abnormality;FunDO |
|
External Links |
|
Links to Entrez Gene | 7428 |
Links to all GeneRIF Items | 7428 |
Links to iHOP | 7428 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>7428 : length: 642 atgccccggagggcggagaactgggacgaggccgaggtaggcgcggaggaggcaggcgtc gaagagtacggccctgaagaagacggcggggaggagtcgggcgccgaggagtccggcccg gaagagtccggcccggaggaactgggcgccgaggaggagatggaggccgggcggccgcgg cccgtgctgcgctcggtgaactcgcgcgagccctcccaggtcatcttctgcaatcgcagt ccgcgcgtcgtgctgcccgtatggctcaacttcgacggcgagccgcagccctacccaacg ctgccgcctggcacgggccgccgcatccacagctaccgaggtcacctttggctcttcaga gatgcagggacacacgatgggcttctggttaaccaaactgaattatttgtgccatctctc aatgttgacggacagcctatttttgccaatatcacactgccagtgtatactctgaaagag cgatgcctccaggttgtccggagcctagtcaagcctgagaattacaggagactggacatc gtcaggtcgctctacgaagatctggaagaccacccaaatgtgcagaaagacctggagcgg ctgacacaggagcgcattgcacatcaacggatgggagattga |
Protein Sequence |
>7428 : length: 213 MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDI VRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |