| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 84525 |
Name | HOPX |
Synonym | CAMEO|HOD|HOP|LAGY|NECC1|OB1|SMAP31|TOTO;HOP homeobox;HOPX;HOP homeobox |
Definition | homeodomain-only protein|lung cancer-associated Y protein|not expressed in choriocarcinoma clone 1|not expressed in choriocarcinoma protein 1|odd homeobox 1 protein|odd homeobox protein 1 |
Position | 4q12 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 8522 |
TUSON P-value | 1 |
| Caution | This gene might be oncogene according to our integrated oncogene list. |
|
Pathways and Diseases |
|
Pathway | hop pathway in cardiac development;PID BioCarta;100143 |
|
External Links |
|
Links to Entrez Gene | 84525 |
Links to all GeneRIF Items | 84525 |
Links to iHOP | 84525 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>84525 : length: 222 atgtcggcggagaccgcgagcggccccacagaggaccaggtggaaatcctggagtacaac ttcaacaaggtcgacaagcacccggattccaccacgctgtgcctcatcgcggccgaggca ggcctttccgaggaggagacccagaaatggtttaagcagcgcctggcaaagtggcggcgc tcagaaggcctgccctcagagtgcagatccgtcacagactaa |
Protein Sequence |
>84525 : length: 73 MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRR SEGLPSECRSVTD |