| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8870 |
Name | IER3 |
Synonym | DIF-2|DIF2|GLY96|IEX-1|IEX-1L|IEX1|PRG1;immediate early response 3;IER3;immediate early response 3 |
Definition | PACAP-responsive gene 1 protein|anti-death protein|differentiation-dependent gene 2 protein|expressed in pancreatic carcinoma|gly96, mouse, homolog of|immediate early protein GLY96|immediate early response 3 protein|immediately early gene X-1|protein DIF- |
Position | 6p21.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 8730 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 8870 |
Links to all GeneRIF Items | 8870 |
Links to iHOP | 8870 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>8870 : length: 471 atgtgtcactctcgcagctgccacccgaccatgaccatcctgcaggccccgaccccggcc ccctccaccatcccgggaccccggcggggctccggtcctgagatcttcaccttcgaccct ctcccggagcccgcagcggcccctgccgggcgccccagcgcctctcgcgggcaccgaaag cgcagccgcagggttctctaccctcgagtggtccggcgccagctgccagtcgaggaaccg aacccagccaaaaggcttctctttctgctgctcaccatcgtcttctgccagatcctgatg gctgaagagggtgtgccggcgcccctgcctccagaggacgcccctaacgccgcatccctg gcgcccacccctgtgtccgccgtcctcgagccctttaatctgacttcggagccctcggac tacgctctggacctcagcactttcctccagcaacacccggccgccttctaa |
Protein Sequence |
>8870 : length: 156 MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL APTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF |