| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9141 |
Name | PDCD5 |
Synonym | TFAR19;programmed cell death 5;PDCD5;programmed cell death 5 |
Definition | TF-1 cell apoptosis-related protein 19|TF1 cell apoptosis-related gene 19|TFAR19 novel apoptosis-related|programmed cell death protein 5 |
Position | 19q13.11 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 12522 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 9141 |
Links to all GeneRIF Items | 9141 |
Links to iHOP | 9141 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>9141 : length: 378 atggcggacgaggagcttgaggcgctgaggagacagaggctggccgagctgcaggccaaa cacggggatcctggtgatgcggcccaacaggaagcaaagcacagggaagcagaaatgaga aacagtatcttagcccaagttctggatcagtcggcccgggccaggttaagtaacttagca cttgtaaagcctgaaaaaactaaagcagtagagaattaccttatacagatggcaagatat ggacaactaagtgagaaggtatcagaacaaggtttaatagaaatccttaaaaaagtaagc caacaaacagaaaagacaacaacagtgaaattcaacagaagaaaagtaatggactctgat gaagatgacgattattga |
Protein Sequence |
>9141 : length: 125 MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLA LVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSD EDDDY |