|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 10217 |
Name | CTDSPL |
Synonym | C3orf8|HYA22|PSR1|RBSP3|SCP3;CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like;CTDSPL;CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like |
Definition | CTD small phosphatase-like protein|CTDSP-like|NIF-like protein|NLI-interacting factor 1|RB protein serine phosphatase from chromosome 3|carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3|nuclear LIM interactor-interacting factor 1 |
Position | 3p21.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
Evidence Status |
Description |
reviewed | "MiR-100 regulates cell differentiation and survival by targeting RBSP3, a phosphatase-like tumor suppressor in acute myeloid leukemia." |
reviewed | "tumor suppressor genes RBSP3/CTDSPL, NPRL2/G21 and RASSF1A are downregulated in primary non-small cell lung cancer". |
reviewed | High mutability of the tumor suppressor genes RASSF1 and RBSP3 (CTDSPL) in cancer. |
potential | "analysis of RBSP3/HYA22located in the AP20 region, and evidence for tumor suppressor function". |
More detail of all 4 literatures about CTDSPL | |
External Links |
|
Links to Entrez Gene | 10217 |
Links to all GeneRIF Items | 10217 |
Links to iHOP | 10217 |
Sequence Information |
|
Nucleotide Sequence |
>10217 : length: 831 atggacggcccggccatcatcacccaggtgaccaaccccaaggaggacgagggccggttg ccgggcgcgggcgagaaagcctcccagtgcaacgtcagcttaaagaagcagaggagccgc agcatccttagctccttcttctgctgcttccgtgattacaatgtggaggcccctccaccc agcagccccagtgtgcttccgccactggtggaggagaatggtgggcttcagaagggtgac cagaggcaggtcattcccataccaagtccaccagctaagtaccttcttccagaggtgacg gtgcttgactatggaaagaaatgtgtggtcattgatttagatgaaacattggtgcacagt tcgtttaagcctattagtaatgctgattttattgttccggttgaaatcgatggaactata catcaggtgtatgtgctgaagcggccacatgtggacgagttcctccagaggatggggcag ctttttgaatgtgtgctctttactgccagcttggccaagtatgcagaccctgtggctgac ctcctagaccgctggggtgtgttccgggcccggctcttcagagaatcatgtgtttttcat cgtgggaactacgtgaaggacctgagtcgccttgggcgggagctgagcaaagtgatcatt gttgacaattcccctgcctcatacatcttccatcctgagaatgcagtgcctgtgcagtcc tggttcgatgacatgacggacacggagctgctggacctcatccccttctttgagggcctg agccgggaggacgacgtgtacagcatgctgcacagactctgcaataggtag |
Protein Sequence |
>10217 : length: 276 MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPP SSPSVLPPLVEENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHS SFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVAD LLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQS WFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |