|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1029 |
Name | CDKN2A |
Synonym | ARF|CDK4I|CDKN2|CMM2|INK4|INK4A|MLM|MTS-1|MTS1|P14|P14ARF|P16|P16-INK4A|P16INK4|P16INK4A|P19|P19ARF|TP16;cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4);CDKN2A;cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) |
Definition | CDK4 inhibitor p16-INK4|cell cycle negative regulator beta|cyclin-dependent kinase 4 inhibitor A|cyclin-dependent kinase inhibitor 2A|multiple tumor suppressor 1 |
Position | 9p21 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,Generif,UniProt |
Literature support | Count: 136 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | tumor suppressor p16INK4A: structural characterization of wild-type and mutant proteins by NMR and circular dichroism. |
reviewed | Somatic mutations of the MTS (multiple tumor suppressor) 1/CDK4l (cyclin-dependent kinase-4 inhibitor) gene in human primary non-small cell lung carcinomas. |
reviewed | tumor suppressor p16INK4a controls oncogenic K-Ras function in human pancreatic cancer cells. |
reviewed | The tumor suppressor p33ING1b upregulates p16INK4a expression and induces cellular senescence. |
reviewed | tumor suppressor and aging biomarker p16(INK4a) induces cellular senescence without the associated inflammatory secretory phenotype. |
reviewed | Interaction of the ARF tumor suppressor with cytosolic HSP70 contributes to its autophagy function. |
reviewed | Regulatory mechanisms of tumor suppressor P16(INK4A) and their relevance to cancer. |
reviewed | "Cancerous tissues from 30 patients with HPSCC were examined for LOH in 4 tumor suppressor genes (TSGs) (p16, Rb, E-cadherin, and p53) at loci 9p21, 13q21, 6q22, and 17p13, respectively, using microsatellite markers amplified by polymerase chain reaction." |
reviewed | p16(Ink4a) overexpression in cancer: a tumor suppressor gene associated with senescence and high-grade tumors. |
reviewed | [Expression of ubiquitin associated protein 1 gene and tumor-suppressor gene p16 in acute leukemia]. |
| More detail of all 136 literatures about CDKN2A | |
|
Pathways and Diseases |
|
Pathway | Regulation of retinoblastoma protein;PID Curated;200191 |
Pathway | Hypoxic and oxygen homeostasis regulation of HIF-1-alpha;PID Curated;200122 |
Pathway | cell cycle: g1/s check point;PID BioCarta;100160 |
Pathway | FOXM1 transcription factor network;PID Curated;200120 |
Pathway | C-MYC pathway;PID Curated;200093 |
Pathway | Pancreatic cancer;KEGG PATHWAY;hsa05212 |
Pathway | p53 pathway;PID Curated;200175 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237 |
Pathway | ctcf: first multivalent nuclear factor;PID BioCarta;100194 |
Pathway | E2F transcription factor network;PID Curated;200027 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | Melanoma;KEGG PATHWAY;hsa05218 |
Pathway | Glioma;KEGG PATHWAY;hsa05214 |
Pathway | cyclins and cell cycle regulation;PID BioCarta;100207 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | Coregulation of Androgen receptor activity;PID Curated;200038 |
Pathway | C-MYB transcription factor network;PID Curated;200130 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Disease | esophageal squamous cell carcinoma;GAD |
Disease | familial melanoma;GAD |
Disease | Oral cancer;FunDO |
Disease | Eating disorder;FunDO |
Disease | Diabetes;KEGG DISEASE |
Disease | Skin cancers;KEGG DISEASE |
Disease | Osteosarcoma;KEGG DISEASE;H00036 |
Disease | Viral infections;KEGG DISEASE |
Disease | Hamman-Rich syndrome;FunDO |
Disease | Non-small cell lung cancer;KEGG DISEASE;H00014 |
Disease | Orolaryngeal cancer, multiple;OMIM |
Disease | Bladder cancer;KEGG DISEASE;H00022 |
Disease | Stroke;GAD |
Disease | Penile cancer;KEGG DISEASE;H00025 |
Disease | Li-Fraumeni syndrome;OMIM |
Disease | Cancers of the nervous system;KEGG DISEASE |
Disease | Hypertension;FunDO |
Disease | Malignant melanoma;KEGG DISEASE;H00038 |
Disease | Burkitt lymphoma;KEGG DISEASE;H00008 |
Disease | Nasopharyngeal cancer;KEGG DISEASE;H00054 |
Disease | Abdominal aortic aneurysm;NHGRI |
Disease | Type II diabetes mellitus;KEGG DISEASE;H00409 |
Disease | Cancer;FunDO |
Disease | Adult T-cell leukemia;KEGG DISEASE;H00009 |
Disease | myocardial infarct;GAD |
Disease | Pancreatic cancer;KEGG DISEASE;H00019 |
Disease | overall effect;GAD |
Disease | Coronary heart disease;NHGRI |
Disease | Infections caused by retro-transcribing viruses;KEGG DISEASE |
Disease | Ulcerative colitis;FunDO |
Disease | Herpes;FunDO |
Disease | oligodendrogliomas;GAD |
Disease | hypertension;GAD |
Disease | Emphysema;FunDO |
Disease | Pancreatitis;FunDO |
Disease | coronary heart disease;GAD |
Disease | Pancreatic cancer/melanoma syndrome;OMIM |
Disease | Kidney disease;FunDO |
Disease | Cirrhosis;FunDO |
Disease | Myocardial infarction;NHGRI |
Disease | Breast cancer;NHGRI |
Disease | Coronary Disease;GAD |
Disease | melanoma;GAD |
Disease | Glioma;GAD |
Disease | Papillomavirus infection;FunDO |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | Cancers of soft tissues and bone;KEGG DISEASE |
Disease | Oral cancer;KEGG DISEASE;H00016 |
Disease | Myocardial infarction (early onset);NHGRI |
Disease | Type 2 diabetes;NHGRI |
Disease | AGING;GAD |
Disease | type 2 diabetes;GAD |
Disease | adult T-cell leukemia;GAD |
Disease | Adrenal gland hyperfunction;FunDO |
Disease | METABOLIC;GAD |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | breast cancer melanoma;GAD |
Disease | Malignant pleural mesothelioma;KEGG DISEASE;H00015 |
Disease | diabetes, type 2;GAD |
Disease | Coronary Artery Disease;GAD |
Disease | Hepatocellular carcinoma;KEGG DISEASE;H00048 |
Disease | Adenovirus infection;FunDO |
Disease | lung carcinoma;GAD |
Disease | Laryngeal cancer;KEGG DISEASE;H00055 |
Disease | Squamous cell carcinoma;KEGG DISEASE;H00040 |
Disease | Cancers;KEGG DISEASE |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | non-small cell lung carcinoma;GAD |
Disease | Congenital abnormality;FunDO |
Disease | ovarian cancer;GAD |
Disease | Esophageal cancer;KEGG DISEASE;H00017 |
Disease | Protein-energy malnutrition;FunDO |
Disease | Cholangiocarcinoma;KEGG DISEASE;H00046 |
Disease | Malignant islet cell carcinoma;KEGG DISEASE;H00045 |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | Intracranial aneurysm;NHGRI |
Disease | physical function;GAD |
Disease | Chronic myeloid leukemia (CML);KEGG DISEASE;H00004 |
Disease | bladder cancer;GAD |
Disease | Parkinson disease;FunDO |
Disease | Actinic keratosis;FunDO |
Disease | Glioma;NHGRI |
Disease | Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE |
Disease | Cancers of endocrine organs;KEGG DISEASE |
Disease | pancreatic cancer;GAD |
Disease | Melanoma;NHGRI |
Disease | Diabetes mellitus;FunDO |
Disease | Melanoma and neural system tumor syndrome;OMIM |
Disease | Neurofibromatosis 1;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | CANCER;GAD |
Disease | Myocardial Infarction;GAD |
Disease | Endometriosis;FunDO |
Disease | Gallbladder cancer;KEGG DISEASE;H00047 |
Disease | Melanoma, cutaneous malignant, 2;OMIM |
Disease | NEUROLOGICAL;GAD |
Disease | myocardial infarction (early onset);GAD |
Disease | Glioma;KEGG DISEASE;H00042 |
Disease | Intracranial Aneurysm;GAD |
Disease | Barrett's esophagus;FunDO |
Disease | Head and neck cancers;KEGG DISEASE |
|
External Links |
|
Links to Entrez Gene | 1029 |
Links to all GeneRIF Items | 1029 |
Links to iHOP | 1029 |
|
Sequence Information |
|
Nucleotide Sequence |
>1029 : length: 471 atggagccggcggcggggagcagcatggagccttcggctgactggctggccacggccgcg gcccggggtcgggtagaggaggtgcgggcgctgctggaggcgggggcgctgcccaacgca ccgaatagttacggtcggaggccgatccaggtcatgatgatgggcagcgcccgagtggcg gagctgctgctgctccacggcgcggagcccaactgcgccgaccccgccactctcacccga cccgtgcacgacgctgcccgggagggcttcctggacacgctggtggtgctgcaccgggcc ggggcgcggctggacgtgcgcgatgcctggggccgtctgcccgtggacctggctgaggag ctgggccatcgcgatgtcgcacggtacctgcgcgcggctgcggggggcaccagaggcagt aaccatgcccgcatagatgccgcggaaggtccctcagacatccccgattga |
Protein Sequence |
>1029 : length: 156 MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |