|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 1050 |
Name | CEBPA |
Synonym | C/EBP-alpha|CEBP;CCAAT/enhancer binding protein (C/EBP), alpha;CEBPA;CCAAT/enhancer binding protein (C/EBP), alpha |
Definition | CCAAT/enhancer-binding protein alpha|c/EBP alpha |
Position | 19q13.1 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 5 PubMed records as below. |
Evidence Status | Description |
potential | In prostate cancer cells C/EBPalpha cannot function as a tumor suppressor. |
potential | "because C/EBPalpha has been suggested as a potential tumor suppressor in breast cancer, these findings provide important mechanisms whereby 1,25(OH)(2)D(3) may act to inhibit growth of breast cancer cells". |
potential | "aberrant silencing, as well as, inappropriate cytoplasmic localization of C/EBPalpha causes dysregulation of its function, suggesting that C/EBPalpha is a novel candidate tumor suppressor gene in pancreatic cancer cells". |
reviewed | Epigenetic modulation of tumor suppressor CCAAT/enhancer binding protein alpha activity in lung cancer. |
potential | may function as a tumor suppressor that is mutated during tumorigenesis. Abnormalties in C/EBPalpha function contribute to the development of malignancies in a variety of tisues. |
| More detail of all 5 literatures about CEBPA | |
Pathways and Diseases | |
Pathway | E2F transcription factor network;PID Curated;200027 |
Pathway | mapkinase signaling pathway;PID BioCarta;100113 |
Pathway | Regulation of Androgen receptor activity;PID Curated;200102 |
Pathway | keratinocyte differentiation;PID BioCarta;100119 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | C-MYB transcription factor network;PID Curated;200130 |
Pathway | Acute myeloid leukemia;KEGG PATHWAY;hsa05221 |
Disease | Cancers;KEGG DISEASE |
Disease | Acute myeloid leukemia (AML);KEGG DISEASE;H00003 |
Disease | Leukemia, acute myeloid;OMIM |
Disease | Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE |
Disease | Obesity;FunDO |
Disease | Leukemia;FunDO |
Disease | Cancer;FunDO |
Disease | METABOLIC;GAD |
Disease | obesity;GAD |
Disease | Metabolic Syndrome X;GAD |
Disease | Yersinia infection;FunDO |
Disease | Leukopenia;FunDO |
External Links | |
Links to Entrez Gene | 1050 |
Links to all GeneRIF Items | 1050 |
Links to iHOP | 1050 |
Sequence Information | |
Nucleotide Sequence | >1050 : length: 1077 atggagtcggccgacttctacgaggcggagccgcggcccccgatgagcagccacctgcag agccccccgcacgcgcccagcagcgccgccttcggctttccccggggcgcgggccccgcg cagcctcccgccccacctgccgccccggagccgctgggcggcatctgcgagcacgagacg tccatcgacatcagcgcctacatcgacccggccgccttcaacgacgagttcctggccgac ctgttccagcacagccggcagcaggagaaggccaaggcggccgtgggccccacgggcggc ggcggcggcggcgactttgactacccgggcgcgcccgcgggccccggcggcgccgtcatg cccgggggagcgcacgggcccccgcccggctacggctgcgcggccgccggctacctggac ggcaggctggagcccctgtacgagcgcgtcggggcgccggcgctgcggccgctggtgatc aagcaggagccccgcgaggaggatgaagccaagcagctggcgctggccggcctcttccct taccagccgccgccgccgccgccgccctcgcacccgcacccgcacccgccgcccgcgcac ctggccgccccgcacctgcagttccagatcgcgcactgcggccagaccaccatgcacctg cagcccggtcaccccacgccgccgcccacgcccgtgcccagcccgcaccccgcgcccgcg ctcggtgccgccggcctgccgggccctggcagcgcgctcaaggggctgggcgccgcgcac cccgacctccgcgcgagtggcggcagcggcgcgggcaaggccaagaagtcggtggacaag aacagcaacgagtaccgggtgcggcgcgagcgcaacaacatcgcggtgcgcaagagccgc gacaaggccaagcagcgcaacgtggagacgcagcagaaggtgctggagctgaccagtgac aatgaccgcctgcgcaagcgggtggaacagctgagccgcgaactggacacgctgcggggc atcttccgccagctgccagagagctccttggtcaaggccatgggcaactgcgcgtga |
Protein Sequence | >1050 : length: 358 MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |