|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 1848 |
Name | DUSP6 |
Synonym | MKP3|PYST1;dual specificity phosphatase 6;DUSP6;dual specificity phosphatase 6 |
Definition | MAP kinase phosphatase 3|dual specificity protein phosphatase 6|dual specificity protein phosphatase PYST1|mitogen-activated protein kinase phosphatase 3|serine/threonine specific protein phosphatase |
Position | 12q22-q23 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 2 PubMed records as below. |
Evidence Status |
Description |
reviewed | tumor suppressor dual-specificity phosphatase 6 (DUSP6) impairs cell invasion and epithelial-mesenchymal transition (EMT)-associated phenotype. |
potential | Results show that DUSP6 exerts apparent tumor-suppressive effects in vitro and suggest that DUSP6 is a strong candidate tumor suppressor gene at 12q22 locus. |
More detail of all 2 literatures about DUSP6 | |
Pathways and Diseases |
|
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Oxidative stress response;PANTHER;P00046 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | ErbB1 downstream signaling;PID Curated;200113 |
Disease | Schizophrenia;FunDO |
Disease | Pancreas cancer;FunDO |
Disease | Breast cancer;FunDO |
Disease | Liver cancer;FunDO |
Disease | Bipolar disorder;FunDO |
External Links |
|
Links to Entrez Gene | 1848 |
Links to all GeneRIF Items | 1848 |
Links to iHOP | 1848 |
Sequence Information |
|
Nucleotide Sequence |
>1848 : length: 1146 atgatagatacgctcagacccgtgcccttcgcgtcggaaatggcgatcagcaagacggtg gcgtggctcaacgagcagctggagctgggcaacgagcggctgctgctgatggactgccgg ccgcaggagctatacgagtcgtcgcacatcgagtcggccatcaacgtggccatcccgggc atcatgctgcggcgcctgcagaagggtaacctgccggtgcgcgcgctcttcacgcgcggc gaggaccgggaccgcttcacccggcgctgtggcaccgacacagtggtgctctacgacgag agcagcagcgactggaacgagaatacgggcggcgagtcggtgctcgggctgctgctcaag aagctcaaggacgagggctgccgggcgttctacctggaaggtggcttcagtaagttccaa gccgagttctccctgcattgcgagaccaatctagacggctcgtgtagcagcagctcgccg ccgttgccagtgctggggctcgggggcctgcggatcagctctgactcttcctcggacatc gagtctgaccttgaccgagaccccaatagtgcaacagactcggatggtagtccgctgtcc aacagccagccttccttcccagtggagatcttgcccttcctctacttgggctgtgccaaa gactccaccaacttggacgtgttggaggaattcggcatcaagtacatcttgaacgtcacc cccaatttgccgaatctctttgagaacgcaggagagtttaaatacaagcaaatccccatc tcggatcactggagccaaaacctgtcccagtttttccctgaggccatttctttcatagat gaagcccggggcaagaactgtggtgtcttggtacattgcttggctggcattagccgctca gtcactgtgactgtggcttaccttatgcagaagctcaatctgtcgatgaacgatgcctat gacattgtcaaaatgaaaaaatccaacatatcccctaacttcaacttcatgggtcagctg ctggacttcgagaggacgctgggactcagcagcccatgtgacaacagggttccagcacag cagctgtattttaccaccccttccaaccagaatgtataccaggtggactctctgcaatct acgtga |
Protein Sequence |
>1848 : length: 381 MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG IMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK KLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ QLYFTTPSNQNVYQVDSLQST |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |