|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 22933 |
Name | SIRT2 |
Synonym | SIR2|SIR2L|SIR2L2;sirtuin 2;SIRT2;sirtuin 2 |
Definition | NAD-dependent deacetylase sirtuin-2|SIR2-like protein 2|silent information regulator 2|sir2-related protein type 2|sirtuin type 2 |
Position | 19q13 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "the absence of SIRT2, a potential tumor suppressor, could play a key role in the regulation of the cell-cycle within a multistep pathway that leads to full cellular transformation and, finally, the development of cellular malignancy". |
| More detail of all 1 literatures about SIRT2 | |
|
Pathways and Diseases |
|
Pathway | Signaling events mediated by HDAC Class III;PID Curated;200020 |
|
External Links |
|
Links to Entrez Gene | 22933 |
Links to all GeneRIF Items | 22933 |
Links to iHOP | 22933 |
|
Sequence Information |
|
Nucleotide Sequence |
>22933 : length: 705 atggacttcctgcggaacttattctcccagacgctcagcctgggcagccagaaggagcgt ctgctggacgagctgaccttggaaggggtggcccggtacatgcagagcgaacgctgtcgc agagtcatctgtttggtgggagctggaatctccacatccgcaggcatccccgactttcgc tctccatccaccggcctctatgacaacctagagaagtaccatcttccctacccagaggcc atctttgagatcagctatttcaagaaacatccggaacccttcttcgccctcgccaaggaa ctctatcctgggcagttcaagccaaccatctgtcactacttcatgcgcctgctgaaggac aaggggctactcctgcgctgctacacgcagaacatagataccctggagcgaatagccggg ctggaacaggaggacttggtggaggcgcacggcaccttctacacatcacactgcgtcagc gccagctgccggcacgaatacccgctaagctggatgaaagagaagatcttctctgaggtg acgcccaagtgtgaagactgtcagagcctggtgaagcctgatatcgtcttttttggtgag agcctcccagcgcgtttcttctcctgtatgcagtcagacttcctgaaggtggacctcctc ctggtcatgggtacctccttgcagggacgtggcctggctgggtga |
Protein Sequence |
>22933 : length: 234 MDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFR SPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKD KGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEV TPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQGRGLAG |