|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 22943 |
Name | DKK1 |
Synonym | DKK-1|SK;dickkopf 1 homolog (Xenopus laevis);DKK1;dickkopf 1 homolog (Xenopus laevis) |
Definition | dickkopf related protein-1|dickkopf-1 like|dickkopf-related protein 1|hDkk-1 |
Position | 10q11.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Wnt antagonist DKK1 acts as a tumor suppressor gene that induces apoptosis and inhibits proliferation in human renal cell carcinoma. |
potential | DKK-1 mediated tumor suppressor effect is independent of beta-catenin dependent transcription and a CamKII pathway contributes to DKK-1 signaling. |
potential | Dickkopf-1 is an epigenetically silenced candidate tumor suppressor gene in medulloblastoma. |
potential | "DKK-1 expression decreases in human colon tumors, suggesting that DKK-1 acts as a tumor suppressor gene in this neoplasia; the Wnt/beta-catenin pathway is downregulated by the induction of DKK-1 expression, a mechanism that is lost in colon cancer". |
| More detail of all 4 literatures about DKK1 | |
|
Pathways and Diseases |
|
Pathway | Presenilin action in Notch and Wnt signaling;PID Curated;200052 |
Pathway | Wnt signaling pathway;KEGG PATHWAY;hsa04310 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Pathway | inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152 |
Pathway | Wnt signaling pathway;PANTHER;P00057 |
Pathway | wnt signaling pathway;PID BioCarta;100002 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | wnt lrp6 signalling;PID BioCarta;100003 |
Pathway | multi-step regulation of transcription by pitx2;PID BioCarta;100074 |
Pathway | Wnt signaling network;PID Curated;200055 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | segmentation clock;PID BioCarta;100146 |
Disease | Electrocardiographic traits;NHGRI |
|
External Links |
|
Links to Entrez Gene | 22943 |
Links to all GeneRIF Items | 22943 |
Links to iHOP | 22943 |
|
Sequence Information |
|
Nucleotide Sequence |
>22943 : length: 801 atgatggctctgggcgcagcgggagctacccgggtctttgtcgcgatggtagcggcggct ctcggcggccaccctctgctgggagtgagcgccaccttgaactcggttctcaattccaac gctatcaagaacctgcccccaccgctgggcggcgctgcggggcacccaggctctgcagtc agcgccgcgccgggaatcctgtacccgggcgggaataagtaccagaccattgacaactac cagccgtacccgtgcgcagaggacgaggagtgcggcactgatgagtactgcgctagtccc acccgcggaggggacgcaggcgtgcaaatctgtctcgcctgcaggaagcgccgaaaacgc tgcatgcgtcacgctatgtgctgccccgggaattactgcaaaaatggaatatgtgtgtct tctgatcaaaatcatttccgaggagaaattgaggaaaccatcactgaaagctttggtaat gatcatagcaccttggatgggtattccagaagaaccaccttgtcttcaaaaatgtatcac accaaaggacaagaaggttctgtttgtctccggtcatcagactgtgcctcaggattgtgt tgtgctagacacttctggtccaagatctgtaaacctgtcctgaaagaaggtcaagtgtgt accaagcataggagaaaaggctctcatggactagaaatattccagcgttgttactgtgga gaaggtctgtcttgccggatacagaaagatcaccatcaagccagtaattcttctaggctt cacacttgtcagagacactaa |
Protein Sequence |
>22943 : length: 266 MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG EGLSCRIQKDHHQASNSSRLHTCQRH |