|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 23410 |
Name | SIRT3 |
Synonym | SIR2L3;sirtuin 3;SIRT3;sirtuin 3 |
Definition | NAD-dependent deacetylase sirtuin-3, mitochondrial|SIR2-like protein 3|mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase|silent mating type information regulation 2, S.cerevisiae, homolog 3|sir2-like 3|sirtuin type 3 |
Position | 11p15.5 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "These results identify SIRT3 as a genomically expressed, mitochondria-localized tumor suppressor." |
potential | "These results identify SIRT3 as a genomically expressed, mitochondria-localized tumor suppressor." |
| More detail of all 1 literatures about SIRT3 | |
|
Pathways and Diseases |
|
Pathway | Signaling events mediated by HDAC Class III;PID Curated;200020 |
Disease | longevity;GAD |
Disease | AGING;GAD |
|
External Links |
|
Links to Entrez Gene | 23410 |
Links to all GeneRIF Items | 23410 |
Links to iHOP | 23410 |
|
Sequence Information |
|
Nucleotide Sequence |
>23410 : length: 774 atggtgggggccggcatcagcacacccagtggcattccagacttcagatcgccggggagt ggcctgtacagcaacctccagcagtacgatctcccgtaccccgaggccatttttgaactc ccattcttctttcacaaccccaagccctttttcactttggccaaggagctgtaccctgga aactacaagcccaacgtcactcactactttctccggctgcttcatgacaaggggctgctt ctgcggctctacacgcagaacatcgatgggcttgagagagtgtcgggcatccctgcctca aagctggttgaagctcatggaacctttgcctctgccacctgcacagtctgccaaagaccc ttcccaggggaggacattcgggctgacgtgatggcagacagggttccccgctgcccggtc tgcaccggcgttgtgaagcccgacattgtgttctttggggagccgctgccccagaggttc ttgctgcatgtggttgatttccccatggcagatctgctgctcatccttgggacctccctg gaggtggagccttttgccagcttgaccgaggccgtgcggagctcagttccccgactgctc atcaaccgggacttggtggggcccttggcttggcatcctcgcagcagggacgtggcccag ctgggggacgtggttcacggcgtggaaagcctagtggagcttctgggctggacagaagag atgcgggaccttgtgcagcgggaaactgggaagcttgatggaccagacaaatag |
Protein Sequence |
>23410 : length: 257 MVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPG NYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRP FPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSL EVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEE MRDLVQRETGKLDGPDK |