|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 23612 |
Name | PHLDA3 |
Synonym | TIH1;pleckstrin homology-like domain, family A, member 3;PHLDA3;pleckstrin homology-like domain, family A, member 3 |
Definition | TDAG51/Ipl homolog 1|pleckstrin homology-like domain family A member 3|pleckstrin homology-like domain, family A, member 2 |
Position | 1q31 |
Gene Type | protein-coding |
Source | Count: 1; UniProt |
Literature support | Count: 0 PubMed records as below. |
Evidence Status |
Description |
| . |
More detail of all 0 literatures about PHLDA3 | |
External Links |
|
Links to Entrez Gene | 23612 |
Links to all GeneRIF Items | 23612 |
Links to iHOP | 23612 |
Sequence Information |
|
Nucleotide Sequence |
>23612 : length: 384 atgacggcggcggcgacggctaccgtgctcaaggagggcgtgctggagaagcgcagcggc gggctgctgcagctgtggaagcggaagcgctgcgtcctcaccgaacgcgggctgcagctc ttcgaggccaagggcacgggcggccggcccaaggagctcagcttcgcccgcatcaaggcc gtggagtgcgtggagagcaccgggcgccacatctacttcacgctggtgaccgaagggggc ggcgagatcgacttccgctgccccctggaagatcccggctggaacgcccagatcacccta ggcctggtcaagttcaagaaccagcaggccatccagacagtgcgggcccggcagagcctc gggaccgggaccctcgtgtcctaa |
Protein Sequence |
>23612 : length: 127 MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKA VECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSL GTGTLVS |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |