|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 2619 |
Name | GAS1 |
Synonym | -;growth arrest-specific 1;GAS1;growth arrest-specific 1 |
Definition | GAS-1|Growth arrest-specific gene-1|growth arrest-specific protein 1 |
Position | 9q21.3-q22 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Gas1 has all the expected properties of a melanoma tumor suppressor: suppression of metastasis in a spontaneous metastasis assay, promotion of apoptosis following dissemination of cells to secondary sites, and down-regulation in human melanoma metastasis." |
| More detail of all 1 literatures about GAS1 | |
|
Pathways and Diseases |
|
Pathway | Signaling events mediated by the Hedgehog family;PID Curated;200144 |
Pathway | FOXM1 transcription factor network;PID Curated;200120 |
Pathway | Hedgehog signaling pathway;KEGG PATHWAY;hsa04340 |
Disease | Hereditary disease;FunDO |
Disease | Embryoma;FunDO |
Disease | CANCER;GAD |
Disease | proximal chromosome 9p to q and distal chromosome 9q;GAD |
|
External Links |
|
Links to Entrez Gene | 2619 |
Links to all GeneRIF Items | 2619 |
Links to iHOP | 2619 |
|
Sequence Information |
|
Nucleotide Sequence |
>2619 : length: 1038 atggtggccgcgctgctgggcggcggcggcgaggcccgcggggggacagtgccgggcgcc tggctgtgcctgatggcgctgctgcagctgctgggctcggcgccgcggggatcggggctg gcgcacggccgccgcctcatctgctggcaggcgctgctgcagtgccagggggagccggag tgcagctacgcctacaaccagtacgccgaggcgtgcgcgccggtgctggcgcagcacggc gggggcgacgcgcccggggccgccgccgccgctttcccggcctcggccgcctctttctcg tcgcgctggcgctgcccgagtcactgcatctcggccctcattcagctcaaccacacgcgc cgcgggcccgccctggaggactgtgactgcgcgcaggacgagaactgcaagtccaccaag cgcgccattgagccgtgcctgccccggacgagcggcggcggcgcgggcggccccggcgcg ggcggggtcatgggctgcaccgaggcccggcggcgctgcgaccgcgacagccgctgcaac ctggcgctgagccgctacctgacctactgcggcaaagtcttcaacgggctgcgctgcacg gacgaatgccgcaccgtcattgaggacatgctggctatgcccaaggcggcgctgctcaac gactgcgtgtgcgacggcctcgagcggcccatctgcgagtcggtcaaggagaacatggcc cgcctgtgcttcggcgccgagctgggcaacggccccggcagcagcggctcggacgggggc ctggacgactactacgatgaggactacgatgacgagcagcgcaccgggggcgcgggtggt gagcagccgctggacgacgacgacggcgtcccgcacccaccgcgcccgggcagcggcgct gctgcatcgggcggccgcggggacctgccctatgggcctgggcgcaggagcagcggcggc ggcggccgcttggcgccccggggcgcctggaccccactcgcctccatcttgctgctgctg cttgggccgctcttttag |
Protein Sequence |
>2619 : length: 345 MVAALLGGGGEARGGTVPGAWLCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPE CSYAYNQYAEACAPVLAQHGGGDAPGAAAAAFPASAASFSSRWRCPSHCISALIQLNHTR RGPALEDCDCAQDENCKSTKRAIEPCLPRTSGGGAGGPGAGGVMGCTEARRRCDRDSRCN LALSRYLTYCGKVFNGLRCTDECRTVIEDMLAMPKAALLNDCVCDGLERPICESVKENMA RLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDGVPHPPRPGSGA AASGGRGDLPYGPGRRSSGGGGRLAPRGAWTPLASILLLLLGPLF |