|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 3486 |
Name | IGFBP3 |
Synonym | BP-53|IBP3;insulin-like growth factor binding protein 3;IGFBP3;insulin-like growth factor binding protein 3 |
Definition | IBP-3|IGF-binding protein 3|IGFBP-3|acid stable subunit of the 140 K IGF complex|binding protein 29|binding protein 53|growth hormone-dependent binding protein|insulin-like growth factor-binding protein 3 |
Position | 7p13-p12 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
potential | "Results showed that IGFBP-3 methylation played an important role in the silencing of its expression, suggesting that IGFBP-3 may act as a tumor suppressor gene in several human cancers examined." |
More detail of all 1 literatures about IGFBP3 | |
Pathways and Diseases |
|
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | hypoxia and p53 in the cardiovascular system;PID BioCarta;100084 |
Pathway | Diabetes pathways;Reactome;REACT:15380 |
Pathway | Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs);PID Reactome;500133 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Disease | overall effect;GAD |
Disease | Cancer;FunDO |
Disease | Skin disease, Genetic;FunDO |
Disease | Sickle cell disease;FunDO |
Disease | Liver disease;FunDO |
Disease | METABOLIC;GAD |
Disease | Stroke;FunDO |
Disease | Cirrhosis;FunDO |
Disease | colorectal cancer;GAD |
Disease | Hamman-Rich syndrome;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | Gestational diabetes;FunDO |
Disease | Hypothyroidism;FunDO |
Disease | Growth Disorders;GAD |
Disease | CANCER;GAD |
Disease | Endometriosis;FunDO |
Disease | Cerebral palsy;FunDO |
Disease | Growth retardation;FunDO |
Disease | breast cancer;GAD |
Disease | Fibromyalgia;FunDO |
Disease | Obesity;FunDO |
Disease | insulin-like growth factor;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Acromegaly;FunDO |
Disease | Metabolic syndrome X;FunDO |
External Links |
|
Links to Entrez Gene | 3486 |
Links to all GeneRIF Items | 3486 |
Links to iHOP | 3486 |
Sequence Information |
|
Nucleotide Sequence |
>3486 : length: 876 atgcagcgggcgcgacccacgctctgggccgctgcgctgactctgctggtgctgctccgc gggccgccggtggcgcgggctggcgcgagctcggcgggcttgggtcccgtggtgcgctgc gagccgtgcgacgcgcgtgcactggcccagtgcgcgcctccgcccgccgtgtgcgcggag ctggtgcgcgagccgggctgcggctgctgcctgacgtgcgcactgagcgagggccagccg tgcggcatctacaccgagcgctgtggctccggccttcgctgccagccgtcgcccgacgag gcgcgaccgctgcaggcgctgctggacggccgcgggctctgcgtcaacgctagtgccgtc agccgcctgcgcgcctacctgctgccagcgccgccagctccaggaaatgctagtgagtcg gaggaagaccgcagcgccggcagtgtggagagcccgtccgtctccagcacgcaccgggtg tctgatcccaagttccaccccctccattcaaagataatcatcatcaagaaagggcatgct aaagacagccagcgctacaaagttgactacgagtctcagagcacagatacccagaacttc tcctccgagtccaagcgggagacagaatatggtccctgccgtagagaaatggaagacaca ctgaatcacctgaagttcctcaatgtgctgagtcccaggggtgtacacattcccaactgt gacaagaagggattttataagaaaaagcagtgtcgcccttccaaaggcaggaagcggggc ttctgctggtgtgtggataagtatgggcagcctctcccaggctacaccaccaaggggaag gaggacgtgcactgctacagcatgcagagcaagtag |
Protein Sequence |
>3486 : length: 291 MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |