|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 3488 |
Name | IGFBP5 |
Synonym | IBP5;insulin-like growth factor binding protein 5;IGFBP5;insulin-like growth factor binding protein 5 |
Definition | IBP-5|IGF-binding protein 5|IGFBP-5|insulin-like growth factor-binding protein 5 |
Position | 2q33-q36 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
potential | IGFBP-5 expression prevented tumor growth and inhibited tumor vascularity in a xenograft model of human ovarian cancer. These results are the first evidence showing that IGFBP-5 plays a role as tumor suppressor by inhibiting angiogenesis. |
More detail of all 1 literatures about IGFBP5 | |
Pathways and Diseases |
|
Pathway | Diabetes pathways;Reactome;REACT:15380 |
Pathway | Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs);PID Reactome;500133 |
Disease | Hamman-Rich syndrome;FunDO |
Disease | Cancer;FunDO |
External Links |
|
Links to Entrez Gene | 3488 |
Links to all GeneRIF Items | 3488 |
Links to iHOP | 3488 |
Sequence Information |
|
Nucleotide Sequence |
>3488 : length: 819 atggtgttgctcaccgcggtcctcctgctgctggccgcctatgcggggccggcccagagc ctgggctccttcgtgcactgcgagccctgcgacgagaaagccctctccatgtgccccccc agccccctgggctgcgagctggtcaaggagccgggctgcggctgctgcatgacctgcgcc ctggccgaggggcagtcgtgcggcgtctacaccgagcgctgcgcccaggggctgcgctgc ctcccccggcaggacgaggagaagccgctgcacgccctgctgcacggccgcggggtttgc ctcaacgaaaagagctaccgcgagcaagtcaagatcgagagagactcccgtgagcacgag gagcccaccacctctgagatggccgaggagacctactcccccaagatcttccggcccaaa cacacccgcatctccgagctgaaggctgaagcagtgaagaaggaccgcagaaagaagctg acccagtccaagtttgtcgggggagccgagaacactgcccacccccggatcatctctgca cctgagatgagacaggagtctgagcagggcccctgccgcagacacatggaggcttccctg caggagctcaaagccagcccacgcatggtgccccgtgctgtgtacctgcccaattgtgac cgcaaaggattctacaagagaaagcagtgcaaaccttcccgtggccgcaagcgtggcatc tgctggtgcgtggacaagtacgggatgaagctgccaggcatggagtacgttgacggggac tttcagtgccacaccttcgacagcagcaacgttgagtga |
Protein Sequence |
>3488 : length: 272 MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |