|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 3622 |
Name | ING2 |
Synonym | ING1L|p33ING2;inhibitor of growth family, member 2;ING2;inhibitor of growth family, member 2 |
Definition | ING1Lp|inhibitor of growth 1-like protein|inhibitor of growth protein 2|p32 |
Position | 4q35.1 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 10 PubMed records as below. |
Evidence Status | Description |
reviewed | HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. |
potential | Expression of candidate tumor suppressor gene ING2 is lost in non-small cell lung carcinoma. |
reviewed | the interaction between Alien and the tumor suppressors p33ING1 and p33ING2 reveals a novel cellular protein network. |
reviewed | Leucine zipper-like domain is required for tumor suppressor ING2-mediated nucleotide excision repair and apoptosis. |
reviewed | The novel tumor suppressor p33ING2 enhances nucleotide excision repair via inducement of histone H4 acetylation and chromatin relaxation. |
potential | "Alterations in novel candidate tumor suppressor genes, ING1 and ING2 in human lung cancer." |
reviewed | ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation. |
reviewed | The novel tumor suppressor p33ING2 enhances UVB-induced apoptosis in human melanoma cells. |
potential | Role of the Sin3-histone deacetylase complex in growth regulation by the candidate tumor suppressor p33(ING1). |
potential | "Cloning of a novel gene (ING1L) homologous to ING1, a candidate tumor suppressor." |
| More detail of all 10 literatures about ING2 | |
External Links | |
Links to Entrez Gene | 3622 |
Links to all GeneRIF Items | 3622 |
Links to iHOP | 3622 |
Sequence Information | |
Nucleotide Sequence | >3622 : length: 843 atgttagggcagcagcagcagcaactgtactcgtcggccgcgctcctgaccggggagcgg agccggctgctcacctgctacgtgcaggactaccttgagtgcgtggagtcgctgccccac gacatgcagaggaacgtgtctgtgctgcgagagctggacaacaaatatcaagaaacgtta aaggaaattgatgatgtctacgaaaaatataagaaagaagatgatttaaaccagaagaaa cgtctacagcagcttctccagagagcactaattaatagtcaagaattgggagatgaaaaa atacagattgttacacaaatgctcgaattggtggaaaatcgggcaagacaaatggagtta cactcacagtgtttccaagatcctgctgaaagtgaacgagcctcagataaagcaaagatg gattccagccaaccagaaagatcttcaagaagaccccgcaggcagcggaccagtgaaagc cgtgatttatgtcacatggcaaatgggattgaagactgtgatgatcagccacctaaagaa aagaaatccaagtcagcaaagaaaaagaaacgctccaaggccaagcaggaaagggaagct tcacctgttgagtttgcaatagatcctaatgaacctacatactgcttatgcaaccaagtg tcttatggggagatgataggatgtgacaatgaacagtgtccaattgaatggtttcacttt tcatgtgtttcacttacctataaaccaaaggggaaatggtattgcccaaagtgcagggga gataatgagaaaacaatggacaaaagtactgaaaagacaaaaaaggatagaagatcgagg tag |
Protein Sequence | >3622 : length: 280 MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETL KEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMEL HSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKE KKSKSAKKKKRSKAKQEREASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHF SCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |