|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4118 |
Name | MAL |
Synonym | -;mal, T-cell differentiation protein;MAL;mal, T-cell differentiation protein |
Definition | T-cell differentiation protein MAL|T-lymphocyte maturation-associated protein|myelin and lymphocyte protein |
Position | 2cen-q13 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Data suggest that the epigenetic inactivation of MAL, as a candidate tumor suppressor gene, can contribute to human epithelial cell carcinoma and may be served as a biomarker in HNSCC." |
potential | The mal gene which is switched-off in all esophageal squamous cell carcinoma samples can be considered as a tumor suppressor gene. |
| More detail of all 2 literatures about MAL | |
|
Pathways and Diseases |
|
Pathway | role of mal in rho-mediated activation of srf;PID BioCarta;100114 |
Disease | Adenoma;FunDO |
Disease | Esophagus cancer;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Prostate cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 4118 |
Links to all GeneRIF Items | 4118 |
Links to iHOP | 4118 |
|
Sequence Information |
|
Nucleotide Sequence |
>4118 : length: 462 atggcccccgcagcggcgacggggggcagcaccctgcccagtggcttctcggtcttcacc accttgcccgacttgctcttcatctttgagtttatcttcgggggcctggtgtggatcctg gtggcctcctccctggtgccctggcccctggtccagggctgggtgatgttcgtgtctgtg ttctgcttcgtggccaccaccaccttgatcatcctgtacataattggagcccacggtgga gagacttcctgggtcaccttggacgcagcctaccactgcaccgctgccctcttttacctc agcgcctcagtcctggaggccctggccaccatcacgatgcaagacggcttcacctacagg cactaccatgaaaacattgctgccgtggtgttctcctacatagccactctgctctacgtg gtccatgcggtgttctctttaatcagatggaagtcttcataa |
Protein Sequence |
>4118 : length: 153 MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSV FCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYR HYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS |